Recombinant Escherichia coli O7:K1 Protein psiE (psiE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psiE; ECIAI39_4452; Protein PsiE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
psiE
Target Protein Sequence
MTSLSRPRVEFISTILQTVLNLGLLCLGLILVVFLGKETVHLADVLFAPEQTSKYELVEG LVVYFLYFEFIALIVKYFQSGFHFPLRYFVYIGITAIVRLIIVDHKSPLDVLIYSAAILL LVITLWLCNSKRLKRE
Uniprot No.

Target Background

Database Links
Protein Families
PsiE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Escherichia coli O7:K1 Protein psiE?

Recombinant Escherichia coli O7:K1 Protein psiE is a full-length protein (1-136 amino acids) derived from E. coli O7:K1 strain IAI39/ExPEC with the UniProt identifier B7NRZ5. The protein features a His-tag, typically at the N-terminal end, which facilitates purification and detection in experimental systems. The complete amino acid sequence is: MTSLSRPRVEFISTILQTVLNLGLLCLGLILVVFLGKETVHLADVLFAPEQTSKYELVEG LVVYFLYFEFIALIVKYFQSGFHFPLRYFVYIGITAIVRLIIVDHKSPLDVLIYSAAILL LVITLWLCNSKRLKRE . This recombinant protein is commonly expressed in E. coli expression systems and provided as a lyophilized powder for research applications.

How should Recombinant psiE protein be stored and handled for optimal stability?

The optimal storage and handling procedures for Recombinant psiE protein involve multiple considerations to maintain protein integrity. Store the lyophilized powder at -20°C/-80°C upon receipt and avoid repeated freeze-thaw cycles which can lead to protein degradation. For working aliquots, storage at 4°C is recommended for up to one week . When reconstituting the protein, briefly centrifuge the vial prior to opening to bring contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, addition of 5-50% glycerol (final concentration) is recommended before aliquoting and storing at -20°C/-80°C . The manufacturer's default final concentration of glycerol is typically 50%, which serves as a cryoprotectant to prevent protein denaturation during freeze-thaw cycles.

What buffer conditions are optimal for working with Recombinant psiE protein?

The optimal buffer conditions for working with Recombinant psiE protein depend on the specific experimental application, but general guidelines can be established based on manufacturer specifications. The protein is typically provided in a Tris/PBS-based buffer with 6% Trehalose, pH 8.0 or in a Tris-based buffer with 50% glycerol . When designing experiments, researchers should consider maintaining similar buffer conditions to preserve protein structure and function. For functional assays, it may be necessary to dialyze the protein into a buffer that more closely mimics physiological conditions while still maintaining protein stability. Buffer optimization experiments should be conducted if the protein is to be used in applications requiring specific ionic strengths, pH values, or cofactors not present in the storage buffer.

What are the key considerations in experimental design when using Recombinant psiE protein?

Experimental design with Recombinant psiE protein requires careful attention to several critical factors to ensure valid and reproducible results. First, establish appropriate controls including a negative control (buffer only) and potentially a positive control with a well-characterized protein of similar size and properties. Second, determine the optimal protein concentration range through preliminary dose-response experiments, as both insufficient amounts and protein overloading can lead to misleading results . Third, account for the presence of the His-tag, which may influence protein behavior in certain assays; consider including experiments with tag-cleaved protein for validation of key findings .

When designing time-course experiments, consider the protein's stability at experimental temperatures and conditions. Pilot studies should be conducted to determine the window of stability under your specific experimental conditions. Additionally, potential confounding variables such as buffer components, storage conditions, and freeze-thaw cycles should be controlled across all experimental groups . For interaction studies, specifically address the possibility of non-specific binding due to the His-tag or other aspects of the recombinant protein production. Finally, ensure adequate sample size and technical replicates to achieve statistical power, particularly when measuring subtle effects or in high-variability systems .

How can potential inconsistencies in psiE protein activity between different production batches be addressed?

Addressing batch-to-batch variability in recombinant psiE protein requires a systematic approach to quality control and experimental design. Implement these methodological steps to minimize the impact of such inconsistencies:

  • Establish a standardized activity assay specific to psiE protein function that can be performed on each new batch to quantify functional activity rather than relying solely on protein concentration.

  • Maintain an internal reference standard from a well-characterized batch to which all new batches can be compared, storing multiple aliquots of this reference at -80°C.

  • When receiving a new batch, perform parallel experiments with both the new batch and reference standard to establish a conversion factor for activity normalization.

  • Document key parameters for each batch including purity (>90% as determined by SDS-PAGE), specific activity, and effective concentration for standardized assays .

  • Design experiments to include batch as a blocking factor in statistical analyses when using multiple batches cannot be avoided.

Additionally, when publishing research using the protein, report the batch information and any normalization procedures applied to account for batch variability. This transparency enables more accurate replication of your findings by other researchers and contributes to better cross-study comparability in the field.

What analytical methods are most effective for characterizing the structural integrity of Recombinant psiE protein?

Comprehensive characterization of Recombinant psiE protein's structural integrity requires a multi-method analytical approach to assess different aspects of protein structure. SDS-PAGE is the foundational method for evaluating protein purity and approximate molecular weight, with manufacturers typically ensuring >90% purity using this technique . For higher-resolution analysis, size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) provides information on oligomeric state and potential aggregation.

Circular dichroism (CD) spectroscopy is particularly valuable for monitoring secondary structure elements and can serve as a quality control method to confirm proper protein folding between batches. Thermal shift assays using differential scanning fluorimetry (DSF) can assess protein stability under various buffer conditions, helping optimize experimental parameters. For tertiary structure assessment, intrinsic tryptophan fluorescence spectroscopy can provide insights into the folding state of the protein.

For researchers requiring atomic-level structural information, nuclear magnetic resonance (NMR) spectroscopy can be employed for smaller proteins like psiE (136 amino acids), yielding information about dynamic properties and conformational changes upon ligand binding. X-ray crystallography, while more labor-intensive, provides the highest resolution structural data if crystals can be obtained. Finally, hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers a powerful approach for probing protein dynamics and ligand-binding interfaces without requiring crystallization.

The analytical data should be compiled into a comprehensive structural profile that serves as a reference point for batch comparisons and experimental design considerations.

How can Recombinant psiE protein be effectively used in protein-protein interaction studies?

Implementing protein-protein interaction studies with Recombinant psiE protein requires a strategic methodology leveraging its His-tag and known properties. Begin with pull-down assays utilizing the N-terminal His-tag for immobilization on Ni-NTA resin, allowing potential binding partners to be captured from complex mixtures like cell lysates . Eluted complexes should be analyzed by SDS-PAGE followed by Western blotting or mass spectrometry for identification of interaction partners.

For more quantitative analysis, surface plasmon resonance (SPR) or bio-layer interferometry (BLI) provide real-time binding kinetics. The His-tagged psiE can be immobilized on NTA sensor chips, followed by injection of potential binding partners at various concentrations to determine association and dissociation rate constants. When designing these experiments, include proper controls such as an irrelevant His-tagged protein to identify non-specific interactions with the tag itself.

Microscale thermophoresis (MST) offers an alternative approach requiring minimal protein amounts and allowing measurements in solution. For in-cell validation of interactions identified in vitro, consider proximity ligation assays (PLA) or fluorescence resonance energy transfer (FRET) using appropriately tagged versions of psiE and its binding partners. Always verify key interactions using multiple complementary methods, as each technique has inherent limitations and potential artifacts.

What are the optimal conditions for reconstituting lyophilized psiE protein for functional studies?

The reconstitution of lyophilized psiE protein for functional studies requires careful attention to detail to preserve structural integrity and biological activity. Begin by allowing the vial to equilibrate to room temperature before opening to prevent condensation. Centrifuge the vial briefly to ensure all powder is at the bottom before reconstitution . Use deionized, sterile water for initial resuspension to a concentration of 0.1-1.0 mg/mL, adding the liquid slowly to the sides of the vial rather than directly onto the protein powder .

Gentle mixing is critical—avoid vortexing which can cause protein denaturation. Instead, rotate the vial slowly or use very gentle pipetting to dissolve the protein completely. After initial resuspension, consider buffer exchange into your experimental buffer using dialysis or desalting columns if the storage buffer components (Tris/PBS with trehalose) might interfere with your assays.

For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50% (manufacturers typically recommend 50%) before aliquoting into single-use volumes . Always perform functional validation after reconstitution using an established activity assay specific to psiE to confirm that the protein remains biologically active. Document the specific reconstitution conditions that yield optimal activity for future reference and consistency across experiments.

What approaches can be used to investigate the membrane association properties of psiE protein?

Investigating the membrane association properties of psiE protein requires multiple complementary techniques given its sequence characteristics suggesting membrane interaction potential. Begin with computational analysis of the amino acid sequence (MTSLSRPRVEFISTILQTVLNLGLLCLGLILVVFLGKETVHLADVLFAPEQTSKYELVEG LVVYFLYFEFIALIVKYFQSGFHFPLRYFVYIGITAIVRLIIVDHKSPLDVLIYSAAILL LVITLWLCNSKRLKRE), which reveals hydrophobic regions potentially involved in membrane association .

For experimental verification, liposome binding assays represent a controlled approach. Prepare liposomes with compositions mimicking bacterial membranes, incubate with recombinant psiE, and separate bound from unbound protein by centrifugation or gel filtration. Quantify protein partitioning between aqueous and membrane phases using SDS-PAGE or Western blotting.

Fluorescence techniques provide additional insights—label the protein with environment-sensitive fluorophores that change emission properties upon membrane interaction. Alternatively, employ FRET between labeled protein and membrane-embedded probes to measure association distances with nanometer precision.

For structural studies during membrane association, attenuated total reflection Fourier transform infrared spectroscopy (ATR-FTIR) can monitor secondary structure changes upon membrane binding. Neutron reflectometry offers detailed information about the depth and orientation of protein insertion into membranes.

Finally, in-cell verification using bacterial spheroplasts or membrane fractions provides physiologically relevant contexts for examining psiE-membrane interactions, potentially revealing functional consequences of these associations in the native environment.

How should researchers address potential experimental artifacts when working with His-tagged psiE protein?

Addressing potential artifacts associated with His-tagged psiE protein requires a systematic approach to experimental design and data interpretation. The His-tag, while facilitating purification, may influence protein behavior in several ways. Implement these methodological strategies to identify and mitigate tag-related artifacts:

First, when possible, compare the behavior of the His-tagged protein with a tag-cleaved version using precision proteases designed for tag removal. This direct comparison serves as the gold standard for identifying tag-induced artifacts. Second, include control experiments with an irrelevant His-tagged protein of similar size to distinguish between specific psiE effects and non-specific effects due to the presence of the His-tag .

For interaction studies, verify findings using reciprocal approaches—if you initially used immobilized His-tagged psiE to pull down a partner protein, confirm the interaction by immobilizing the partner and detecting psiE association. Consider tag position effects by comparing N-terminal versus C-terminal His-tagged versions of psiE when feasible.

In activity assays, establish a clear dose-response relationship to distinguish between specific activity and potential artificial effects at high protein concentrations. Finally, employ complementary detection methods that rely on different principles to verify key findings, reducing the likelihood that observed effects are artifacts of a particular experimental approach rather than genuine biological phenomena.

What statistical approaches are most appropriate for analyzing variability in psiE protein experiments?

When analyzing variability in psiE protein experiments, researchers should employ statistical approaches that address both biological and technical sources of variation. For experimental design, power analysis should be conducted prior to experiments to determine appropriate sample sizes based on expected effect sizes and variability . A minimum of three biological replicates is essential, with each including at least two technical replicates to assess measurement precision.

Analysis of variance (ANOVA) frameworks are particularly valuable for experiments with multiple factors (e.g., protein concentration, temperature, time points). Mixed-effects models should be employed when dealing with repeated measures or nested experimental designs, allowing proper accounting for correlation structures within the data. For multiple comparisons, apply appropriate correction methods such as Bonferroni or false discovery rate (FDR) to control Type I error rates .

Non-parametric methods (e.g., Kruskal-Wallis test followed by Dunn's test) should be considered when data do not meet normality assumptions, which should be verified through formal tests and visual inspection of residuals. For dose-response experiments, consider using four-parameter logistic regression models to characterize EC50 values and Hill slopes rather than analyzing individual concentrations separately.

How can researchers validate the functional activity of recombinant psiE protein in their experimental systems?

Validating the functional activity of recombinant psiE protein requires a multi-faceted approach due to the limited published information on its specific biochemical functions. Begin by establishing a baseline characterization panel including SDS-PAGE for purity assessment (confirming >90% purity) , circular dichroism spectroscopy to verify proper folding, and dynamic light scattering to assess monodispersity and absence of aggregation.

For functional validation, a comparative approach is recommended. If working with psiE for the first time, include positive controls of well-characterized proteins from the same family or with similar predicted functions. Consider developing a specific activity assay based on bioinformatic predictions of psiE function, which can serve as a quality control benchmark across experiments and batches.

The effect of environmental conditions on protein activity should be systematically evaluated, creating a functional stability profile across different temperatures, pH values, and buffer compositions. This profile will establish optimal conditions for subsequent experiments and identify potential sources of variability.

For in vivo relevance, complement assays using E. coli strains with psiE gene deletions can provide functional evidence. If complementation restores a phenotype, this strongly supports the functional activity of your recombinant protein. Additionally, competitive binding assays with native ligands or interaction partners (if known) can verify that the recombinant protein maintains proper binding capabilities.

Document all validation results comprehensively to establish a reference standard for your specific experimental system, facilitating troubleshooting if unexpected results occur in subsequent experiments.

How can proteomic approaches be integrated with recombinant psiE studies to advance understanding of its biological role?

Integrating proteomic approaches with recombinant psiE studies offers powerful strategies for elucidating its biological functions and interaction networks. Begin with affinity purification-mass spectrometry (AP-MS) by immobilizing His-tagged psiE on Ni-NTA resin and incubating with cellular extracts from relevant E. coli strains . Stringent washing followed by on-bead digestion and LC-MS/MS analysis can identify the psiE interactome, providing insights into potential functional pathways.

Proximity-based labeling techniques such as BioID or APEX2 represent advanced approaches—generate fusion proteins of psiE with these enzymes, express them in E. coli, and identify proteins that become labeled due to their proximity to psiE in the cellular environment. This approach captures even transient interactions that might be missed by conventional pull-down methods.

Cross-linking mass spectrometry (XL-MS) offers structural insights by covalently linking psiE to its interaction partners before MS analysis, revealing not only binding partners but also specific interaction interfaces. For detecting post-translational modifications that might regulate psiE function, phosphoproteomics, glycoproteomics, or other modification-specific analyses can be applied to samples enriched for psiE and its interactors.

The data from these proteomic approaches should be integrated using bioinformatic tools to construct functional networks, which can then be validated through targeted biochemical or genetic experiments. This systems-level understanding can position psiE within its broader biological context, generating testable hypotheses about its roles in bacterial physiology or virulence.

What are the considerations for using recombinant psiE protein in structural biology studies?

Structural biology studies with recombinant psiE protein require careful planning to overcome potential challenges associated with membrane-associated bacterial proteins. X-ray crystallography remains the gold standard for high-resolution structural determination, but obtaining diffraction-quality crystals may be challenging due to the hydrophobic regions in psiE . Consider incorporating the following methodological approaches to increase success probability:

First, optimize protein construct design—evaluate multiple constructs with variations in terminal regions or solubility-enhancing fusion partners while maintaining the core functional domains. For crystallization screening, employ sparse matrix approaches with hundreds of conditions, focusing on those successful with similar bacterial proteins. Consider crystallization in lipidic environments if membrane association is physiologically relevant.

Nuclear Magnetic Resonance (NMR) spectroscopy offers an alternative approach for solution-state structural studies, particularly valuable for capturing conformational dynamics. For this technique, prepare isotopically labeled protein (15N, 13C) by expressing in minimal media with labeled nutrients. The relatively small size of psiE (136 amino acids) makes it amenable to NMR studies without requiring deuteration.

Cryo-electron microscopy (cryo-EM) should be considered if psiE forms larger complexes with interaction partners, potentially bypassing crystallization requirements. For membrane-association studies, cryo-EM of psiE reconstituted into nanodiscs can provide insights into its membrane-bound conformation.

Small-angle X-ray scattering (SAXS) offers lower-resolution envelope information but can be valuable for assessing oligomeric states and conformational changes upon ligand binding or environmental alterations. This technique requires highly monodisperse protein samples and careful buffer matching.

Complement structural studies with computational approaches like molecular dynamics simulations to explore dynamic properties and potential conformational changes under various conditions.

How might recombinant psiE protein be utilized in developing novel antimicrobial strategies?

Utilizing recombinant psiE protein in antimicrobial research represents a sophisticated approach that capitalizes on bacterial-specific targets for therapeutic development. The first step involves comprehensive characterization of psiE's role in bacterial physiology through knockout and complementation studies, identifying whether it contributes to survival, virulence, or stress response in pathogenic E. coli strains .

If psiE proves essential or significantly impacts bacterial fitness, high-throughput screening assays can be developed using the recombinant protein to identify small molecule inhibitors. Design an activity-based assay or competitive binding assay depending on psiE's function, and screen compound libraries against the purified protein. Hits should be validated using secondary assays that assess specificity and mechanism of action.

For structure-based drug design approaches, leverage the three-dimensional structure of psiE (determined through X-ray crystallography, NMR, or computational modeling) to identify potential binding pockets amenable to small molecule interaction. In silico docking and virtual screening can prioritize compounds for experimental validation.

Antibody-based approaches represent another strategy—use the recombinant protein to generate monoclonal antibodies that specifically recognize surface-exposed epitopes of psiE. These antibodies can be evaluated for their ability to neutralize bacterial function or enhance immune clearance in infection models.

Finally, consider psiE as a potential vaccine antigen if it is surface-exposed and conserved across pathogenic strains. Immunization studies with the recombinant protein, followed by challenge with virulent bacteria, can assess protective efficacy. Each of these approaches requires careful consideration of psiE's localization, conservation, and functional importance in the targeted pathogenic strains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.