Recombinant Escherichia coli O7:K1 Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is expressed in E. coli systems, optimized for high yield and purity :

  • Expression: Induced under controlled conditions (e.g., T7 RNA polymerase system) with arabinose induction .

  • Purification:

    • IMAC: Nickel-affinity chromatography isolates His-tagged GlpG .

    • SEC: Size-exclusion chromatography ensures monodispersity .

  • Yield: 1–2.5 mg per liter of culture, with >85% purity confirmed by SDS-PAGE .

Storage: Lyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0) or reconstituted in glycerol for long-term stability .

Biochemical Activity

GlpG cleaves substrates at hydrophilic juxtamembrane regions rather than within transmembrane domains . Key findings include:

  • Substrate Specificity: Prefers small residues (e.g., Ser, Ala) at the P1 position preceding the cleavage site .

  • Mechanism: Catalytic triad (Ser-His) mediates hydrolysis, with substrate recognition dependent on transmembrane segment features .

SubstrateCleavage SiteKey Reference
Bla-LY2-MBPPeriplasm-membrane boundary
Gurken transmembraneHydrophilic region exposure
Pro-σK (modified)S20G substitution enhances cleavage

Functional and Pathogenic Roles

GlpG contributes to E. coli fitness in host environments:

  • Metabolic Support: Processes fatty acids in intestinal mucus, aiding persistence in the gut .

  • Regulated Intramembrane Proteolysis (RIP): Activates virulence factors by cleaving membrane-bound precursors .

Applications in Research

  • Structural Studies: Used in crystallography to resolve mechanisms of intramembrane proteolysis .

  • Enzyme Kinetics: Assayed to determine substrate preferences and inhibitor efficacy .

  • Disease Modeling: Investigated in E. coli pathogenesis, including urinary tract infections and sepsis .

Comparative Analysis of Recombinant GlpG Variants

StrainHost SystemPurityTagKey Use
O7:K1 E. coli≥85%His-tagSubstrate specificity studies
O157:H7 Yeast/Mammalian≥85%NonePathogenesis assays
Klebsiella pneumoniae E. coli>90%His-tagCross-species functional studies

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format preferences, please indicate them during order placement. We will accommodate your requests whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is preferred, please communicate with us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
glpG; ECIAI39_3904; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQSGHTDSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is rhomboid protease GlpG and what is its significance in E. coli?

Rhomboid proteases, including GlpG from Escherichia coli, belong to a ubiquitous family of intramembrane serine proteases that hydrolyze substrate peptide bonds within the lipid bilayer. These proteases are involved in various signaling pathways and represent a fascinating class of enzymes with active sites buried within the lipid environment . GlpG from E. coli serves as one of the primary model systems for structural investigations of the rhomboid family, providing valuable insights into the mechanisms of intramembrane proteolysis . The enzyme's importance lies in its role as a prototype for understanding more complex rhomboid proteases in various organisms, including those with significant roles in human health and disease.

What is known about the structure of E. coli GlpG?

The structure of E. coli GlpG has been extensively studied using various techniques, particularly X-ray crystallography in detergent micelles. High-resolution structures with various inhibitors have revealed the catalytic mechanism for rhomboid-mediated proteolysis . More recent investigations using solid-state NMR spectroscopy of enzymatically active GlpG in a native-like lipid environment have confirmed the presence of water molecules in the catalytic cavity, which is crucial for its hydrolytic activity .

Structurally, GlpG contains transmembrane helices with a notable feature being the gating helix TM5. Solid-state NMR analyses have identified a previously unobserved kink in the central part of TM5 . Additionally, dynamics measurements have revealed a dynamic hotspot at the N-terminal part of TM5 and the adjacent loop L4, suggesting that this region plays a critical role in substrate gating . Relaxation dispersion experiments further indicate that TM5 exists in conformational exchange between open and closed states, providing insights into the structural dynamics associated with enzyme function .

What are the known substrates for bacterial rhomboid proteases?

The identification of natural substrates for rhomboid proteases has been challenging for researchers in this field. Currently, TatA is recognized as the only known natural substrate for bacterial rhomboids, including GlpG . TatA is used in assays to measure catalytic parameters of rhomboid proteases. In addition to this natural substrate, researchers employ model substrates such as fluorescently labeled casein to evaluate enzymatic activity in experimental settings . The limited number of known substrates represents one of the significant challenges in studying rhomboid proteases and continues to be an active area of research.

What methodologies are currently employed to assess rhomboid protease activity, and what are their limitations?

Several assay methods have been developed over the past decade to study rhomboid protease activity, addressing the challenges posed by the lipid environment and the limited number of known substrates . These methodologies can be categorized as follows:

1. Gel-shift Assays:
These assays involve detecting the proteolytic processing of substrates through size differences on polyacrylamide gels. The protocol typically includes:

  • Incubation of purified rhomboid protease with substrate in appropriate buffer conditions

  • Separation of reaction products by SDS-PAGE

  • Visualization through staining or fluorescence detection

  • Quantification by densitometric analysis

2. FRET-based Assays:
Förster Resonance Energy Transfer (FRET) assays utilize fluorescently labeled substrates with donor and acceptor fluorophores. The protocol involves:

  • Preparation of substrate with appropriate FRET pairs

  • Monitoring real-time proteolysis through changes in fluorescence emission

  • Calculation of reaction rates based on fluorescence changes

  • Determination of enzyme kinetics under various conditions

3. Calculation of Enzymatic Parameters:
These approaches enable determination of key enzymatic parameters:

  • Measurement of KM and Vmax using varying substrate concentrations

  • Assessment of catalytic efficiency (kcat/KM) under different conditions

  • Evaluation of inhibitor potency through IC50 or Ki determination

Limitations of Current Methodologies:

  • The lipid environment significantly influences enzyme activity but is challenging to standardize across experiments

  • Limited availability of known natural substrates restricts physiological relevance

  • Detergent solubilization may alter native enzyme conformation and activity

  • Variability in expression systems affects protein folding and post-translational modifications

  • Difficulties in distinguishing between effects on substrate binding versus catalytic activity

How does the molecular structure of GlpG relate to its gating mechanism in the bacterial membrane?

The gating mechanism of GlpG in the bacterial membrane is a sophisticated process that involves specific structural elements undergoing conformational changes to allow substrate access to the catalytic site. Based on recent research using solid-state NMR spectroscopy, two different models of substrate gating have been proposed :

Key Structural Elements Involved in Gating:

  • Transmembrane Helix 5 (TM5): This helix functions as the primary gating element. NMR studies have revealed:

    • A previously unobserved kink in the central part of TM5

    • Conformational exchange between open and closed states

    • Dynamic properties particularly at the N-terminal region

  • Loop 4 (L4): This loop adjacent to TM5 forms part of the dynamic hotspot and contributes to the gating mechanism .

  • Catalytic Cavity: Water molecules present in this cavity are essential for the hydrolytic function of the enzyme. Their presence has been confirmed through proton-detected NMR experiments .

Gating Mechanism Models:

ModelKey FeaturesSupporting EvidenceLimitations
Lateral MovementTM5 moves laterally to expose catalytic siteCrystal structures in detergent micelles; Dynamics measurementsMay be influenced by detergent environment
Loop MovementL4 undergoes conformational change to allow substrate accessNMR relaxation dispersion data; Dynamic hotspot identificationComplete mechanism not fully elucidated

Recent NMR studies in native-like lipid environments suggest that gating likely involves a combination of movements, with TM5 exhibiting a dynamic N-terminal region that works in concert with L4 to regulate substrate access to the catalytic site . The conformational exchange detected through relaxation dispersion experiments provides strong evidence for an ongoing transition between open and closed states, which is fundamental to the enzyme's function.

What genetic factors influence the expression of recombinant GlpG in E. coli O7:K1 strains?

The expression of recombinant proteins in E. coli, including GlpG in O7:K1 strains, is influenced by multiple genetic factors that must be carefully considered in experimental design. For E. coli O7:K1, specific considerations include:

1. Genomic Context and Native Expression:
The E. coli O7:K1 strain VW187 contains specific genetic elements that affect the expression of membrane proteins. The O7-specific lipopolysaccharide (LPS) synthesis genes (rfb genes) occupy a region of approximately 17 kilobase pairs . These genes and their products can influence the membrane composition, potentially affecting the insertion and proper folding of membrane proteins like GlpG.

2. Promoter Selection:
Expression levels can be modulated through promoter selection:

  • The ptac promoter has been successfully used for expressing O7-specific proteins in E. coli

  • Inducible promoters allow controlled expression, minimizing potential toxicity

  • Constitutive promoters may lead to consistent but potentially lower yield

3. Codon Usage and Optimization:
E. coli O7:K1 strains have specific codon preferences that can impact translation efficiency. Analysis of the rfbEcO7 gene cluster revealed three open reading frames (ORFs) encoding polypeptides of 275, 464, and 453 amino acids, with specific codon usage patterns that influenced expression levels .

4. Fusion Tags and Expression Vectors:
Different fusion tags and vector systems can significantly affect expression:

  • Affinity tags (His, GST, MBP) can improve solubility and facilitate purification

  • The choice of origin of replication affects plasmid copy number and protein yield

  • Signal sequences may improve membrane targeting and insertion

5. Host Strain Considerations:
When expressing O7:K1-derived proteins in other E. coli strains, compatibility issues may arise:

  • Studies have shown that the amount of O7 LPS expressed in E. coli K-12 was considerably lower than that produced by the wild-type strain VW187

  • Southern blot hybridization experiments demonstrated that O7 LPS genes are unique and did not hybridize to genomic DNA digests of E. coli strains belonging to several different O types

How can researchers optimize the purification of functional recombinant GlpG?

Purification of functional membrane proteins like GlpG requires specialized approaches to maintain native conformation and activity. The following methodological framework can be employed:

1. Expression Optimization:

  • Select appropriate E. coli expression strains (C41(DE3), C43(DE3)) designed for membrane protein expression

  • Use induction at lower temperatures (16-20°C) to promote proper folding

  • Consider auto-induction media for gradual protein production

  • Monitor growth curves to identify optimal harvest points before toxicity develops

2. Membrane Extraction and Solubilization:

  • Isolate bacterial membranes through differential centrifugation

  • Select appropriate detergents for solubilization:

    • n-Dodecyl-β-D-maltoside (DDM) is often effective for rhomboid proteases

    • Digitonin provides a milder alternative that may better preserve activity

    • CHAPSO has been used successfully for rhomboid solubilization

  • Optimize detergent concentration and solubilization time to maximize yield while preserving activity

3. Chromatography Strategies:

  • Implement a multi-step purification approach:

    • Affinity chromatography (IMAC for His-tagged constructs)

    • Ion exchange chromatography to remove contaminants

    • Size exclusion chromatography as a final polishing step

  • Maintain detergent above critical micelle concentration throughout purification

  • Consider on-column detergent exchange during purification

4. Activity Preservation:

  • Include appropriate protease inhibitors during early purification steps

  • Add glycerol (10-20%) to stabilize the purified protein

  • Consider lipid supplementation to maintain a native-like environment

  • Perform activity assays at each purification step to monitor functional preservation

5. Quality Control Assessment:

  • Verify purity through SDS-PAGE and Western blotting

  • Confirm proper folding using circular dichroism spectroscopy

  • Validate activity using established assays with model substrates

  • Assess oligomeric state through analytical size exclusion chromatography

What approaches are effective for studying GlpG structure-function relationships?

Understanding the structure-function relationships of GlpG requires integrating multiple experimental approaches. The following methodologies have proven effective:

1. Site-Directed Mutagenesis:
Systematic mutation of key residues can reveal their functional importance:

  • The catalytic dyad (Ser and His) in GlpG can be mutated to confirm essential catalytic roles

  • Residues in the TM5 gating helix can be altered to examine effects on substrate access

  • Mutations in the water-retention cavity can validate the role of water molecules in catalysis

  • Introduction of cysteine residues enables subsequent labeling for dynamics studies

2. Advanced Structural Analysis:
Multiple structural determination methods provide complementary insights:

3. Dynamics Measurements:
Understanding protein motion is critical for comprehending function:

  • NMR relaxation experiments have identified dynamic hotspots at the N-terminal part of TM5 and adjacent loop L4

  • Single-molecule FRET can monitor conformational changes during substrate binding

  • Molecular dynamics simulations can predict motion pathways and energetics

  • Relaxation dispersion experiments have revealed conformational exchange between open and closed states

4. Substrate Specificity Analysis:
Defining the determinants of substrate recognition:

  • Peptide library screening to identify preferred cleavage sequences

  • Chimeric substrates to map recognition elements

  • Competition assays to assess relative binding affinities

  • Cross-linking approaches to capture transient enzyme-substrate complexes

5. Lipid Environment Modulation:
Examining the influence of membrane composition:

  • Reconstitution in different lipid compositions to determine optimal activity conditions

  • Lipid nanodiscs provide a defined, native-like environment for activity studies

  • Fluorescence approaches to monitor protein-lipid interactions

  • Assessment of bilayer thickness effects on enzyme positioning and activity

How can researchers address the challenge of identifying novel substrates for bacterial rhomboid proteases?

The identification of novel substrates represents one of the most significant challenges in rhomboid protease research. Currently, TatA is the only known natural substrate for bacterial rhomboids . The following integrated approach can be employed to discover new substrates:

1. Bioinformatic Prediction:
Computational approaches to identify candidate substrates:

  • Sequence pattern analysis based on known cleavage sites

  • Structural modeling to predict membrane protein topology compatible with rhomboid processing

  • Evolutionary conservation analysis across bacterial species

  • Network analysis to identify potential substrates in relevant pathways

2. Proteomic Screening:
Large-scale experimental approaches:

  • Differential membrane proteomics comparing wild-type and rhomboid-deficient strains

  • Terminal amine isotopic labeling of substrates (TAILS) to identify new N-termini generated by proteolysis

  • Stable isotope labeling with amino acids in cell culture (SILAC) to quantify protein level changes

  • Proximity labeling approaches (BioID, APEX) to identify proteins in close association with rhomboids

3. Synthetic Substrate Libraries:
Systematic screening of potential cleavage sequences:

  • Peptide libraries spanning transmembrane domains of bacterial membrane proteins

  • Fluorogenic substrate arrays for high-throughput activity screening

  • Positional scanning libraries to determine sequence preferences

  • Designer substrate development incorporating favorable features from known substrates

4. Genetic Approaches:
In vivo methods to identify functional relationships:

  • Suppressor screens to identify genetic interactions with rhomboid mutants

  • Bacterial two-hybrid systems to detect protein-protein interactions

  • CRISPR interference screens to identify synthetic lethal interactions

  • Transcriptional profiling to identify co-regulated genes

5. In Vitro Validation:
Confirmation of candidate substrates:

  • Recombinant expression and purification of potential substrates

  • Direct cleavage assays using purified components

  • Kinetic analysis to determine catalytic efficiency

  • Site-directed mutagenesis to map cleavage sites and recognition elements

ApproachAdvantagesLimitationsSuccess Metrics
Bioinformatic PredictionRapid, genome-wide analysisHigh false positive rateNumber of candidates identified
Proteomic ScreeningUnbiased, system-wide viewTechnical complexity, costNovel cleavage sites confirmed
Synthetic LibrariesControlled conditions, quantitativeMay miss context-dependent factorsSubstrate specificity profile
Genetic ApproachesPhysiological relevanceIndirect evidence of processingFunctional relationships established
In Vitro ValidationDirect evidence of cleavageMay not reflect in vivo conditionsKinetic parameters determined

What emerging technologies might advance our understanding of rhomboid proteases?

The field of rhomboid protease research is poised to benefit from several emerging technologies that could address current knowledge gaps:

1. Advanced Imaging Techniques:

  • Cryo-electron tomography to visualize rhomboid proteases in their native membrane environment

  • Super-resolution microscopy to track rhomboid dynamics in living cells

  • Correlative light and electron microscopy (CLEM) to link functional states with structural context

  • High-speed atomic force microscopy to observe conformational changes in real-time

2. Integrative Structural Biology:

  • Combining solid-state NMR, X-ray crystallography, and cryo-EM for comprehensive structural models

  • Hydrogen-deuterium exchange mass spectrometry to map protein dynamics and interactions

  • Cross-linking mass spectrometry to identify interaction interfaces

  • Integrative modeling approaches to synthesize data from multiple experimental sources

3. Synthetic Biology Approaches:

  • Engineered rhomboid variants with expanded substrate specificity

  • Biosensor development for real-time monitoring of rhomboid activity in vivo

  • Cell-free expression systems for high-throughput functional screening

  • Directed evolution to develop rhomboid variants with enhanced activity or altered specificity

4. Advanced Computational Methods:

  • Deep learning approaches for improved substrate prediction

  • Enhanced molecular dynamics simulations of membrane proteins

  • Quantum mechanics/molecular mechanics (QM/MM) calculations to model catalytic mechanisms

  • Network analysis to position rhomboids in broader cellular pathways

These emerging technologies promise to address current challenges in understanding the structural dynamics, substrate recognition, and physiological roles of rhomboid proteases in bacterial systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.