Recombinant Escherichia coli O7:K1 Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli O7:K1 Spermidine Export Protein MdtI (MdtI)

Escherichia coli O7:K1 Spermidine export protein MdtI (MdtI), also known as MdtI, is a protein involved in the export of spermidine, a polyamine essential for cell growth . MdtI is encoded by the mdtI gene and functions as a component of the MdtJI complex, which catalyzes the excretion of spermidine from cells . The MdtJI complex is necessary for recovery from the toxicity caused by overaccumulation of spermidine .

Gene Information and Characteristics

The mdtI gene encodes a protein of 109 amino acids . MdtI belongs to the small multidrug resistance (SMR) family of drug exporters . The protein sequence of E. coli O7:K1 Spermidine export protein MdtI (MdtI) is: MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGIDLSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA .

Table 1: Characteristics of Recombinant Escherichia coli O7:K1 Spermidine Export Protein MdtI (MdtI)

CharacteristicDescription
Gene NamemdtI
SynonymsMdtI; ECIAI39_1459; Spermidine export protein MdtI
UniProt IDB7NUP0
SpeciesE. coli
Protein LengthFull Length (1-109 aa)
TagHis
Amino Acid SequenceMAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGIDLSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Default glycerol is 50%.

Function of MdtJI Complex

  1. Spermidine Excretion: The MdtJI complex catalyzes the excretion of spermidine from E. coli cells, reducing intracellular spermidine levels .

  2. Recovery from Spermidine Toxicity: Overaccumulation of spermidine can be toxic to cells. The MdtJI complex is essential for cells to recover from this toxicity .

  3. Regulation by Spermidine: The level of mdtJI mRNA is increased by spermidine, indicating that the expression of the MdtJI complex is regulated by spermidine levels .

Key Amino Acid Residues Involved in Excretion Activity

Specific amino acid residues in MdtJ and MdtI are crucial for the excretion activity of the MdtJI complex :

  • MdtJ: Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82

  • MdtI: Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81

Role of Polyamines in Cell Growth

Polyamines like putrescine, spermidine, and spermine are essential for normal cell growth . Their intracellular content is regulated through biosynthesis, degradation, uptake, and excretion . The MdtJI complex plays a crucial role in maintaining polyamine homeostasis by facilitating spermidine excretion .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdtI; ECIAI39_1459; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
mdtI
Target Protein Sequence
MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA
Uniprot No.

Target Background

Function
Catalyzes spermidine excretion.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MdtI and what is its primary function in E. coli?

MdtI is a small multidrug resistance (SMR) family protein that functions as part of a spermidine excretion complex in Escherichia coli. The protein consists of 109 amino acids and plays a critical role in polyamine homeostasis by facilitating the export of spermidine from the bacterial cell . MdtI works in conjunction with MdtJ to form a functional complex (MdtJI) that protects E. coli from the toxicity associated with spermidine overaccumulation . This export system is particularly important in bacterial strains that are deficient in spermidine acetyltransferase, which normally metabolizes excess spermidine .

How does the MdtJI complex function in spermidine excretion?

The MdtJI complex constitutes a functional unit where both proteins are essential for spermidine export activity. Research has demonstrated that neither MdtI nor MdtJ alone is sufficient for recovering cells from spermidine-induced toxicity . The complex responds to elevated intracellular spermidine levels by increasing mdtJI mRNA expression, creating a regulatory feedback mechanism . Experimentally, E. coli cells expressing the MdtJI complex show decreased intracellular spermidine content when cultured in media containing 2 mM spermidine, with corresponding increases in extracellular spermidine, confirming the complex's role in active export .

Which amino acid residues are critical for MdtI function?

Site-directed mutagenesis studies have identified several key residues in MdtI that are essential for its spermidine export activity. Specifically, Glu5, Glu19, Asp60, Trp68, and Trp81 in MdtI have been determined to be crucial for the proper functioning of the MdtJI complex . These residues likely participate in substrate recognition, binding, or the conformational changes necessary for transport. The negatively charged glutamate and aspartate residues (Glu5, Glu19, Asp60) may interact with the positively charged spermidine molecule, while the tryptophan residues (Trp68, Trp81) could be involved in maintaining protein structure or in substrate binding through aromatic interactions.

How does MdtI interact with its partner protein MdtJ?

The MdtJI complex requires both proteins to be present for functional spermidine export. In MdtJ, the residues Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 have been identified as important for export activity . The complementary arrangement of charged and aromatic residues between MdtI and MdtJ suggests a coordinated interaction that creates a functional transport channel or pore. While the exact stoichiometry and structural arrangement of the complex have not been fully elucidated, the interdependence of both proteins indicates tight functional coupling.

What is the membrane topology of MdtI?

As a member of the small multidrug resistance (SMR) family, MdtI is likely to have a topology consistent with other SMR proteins, featuring multiple transmembrane domains. The amino acid sequence of MdtI contains hydrophobic segments characteristic of membrane-spanning regions. The precise membrane topology would require experimental determination through methods such as cysteine-scanning mutagenesis, epitope insertion analysis, or structural studies using X-ray crystallography or cryo-electron microscopy.

What expression systems are effective for recombinant MdtI production?

Recombinant MdtI has been successfully expressed in E. coli expression systems with N-terminal His-tags for purification purposes . The protein can be expressed as a full-length construct (1-109 amino acids) and purified to greater than 90% purity as determined by SDS-PAGE . For optimal expression, considerations should include:

  • Selection of an appropriate E. coli strain compatible with membrane protein expression

  • Use of inducible promoter systems (such as T7) for controlled expression

  • Growth conditions optimization (temperature, induction time, media composition)

  • Inclusion of appropriate tags (His-tag is commonly used) for downstream purification

What are the optimal storage and reconstitution conditions for purified MdtI?

Purified recombinant MdtI protein is typically stored as a lyophilized powder. For optimal stability and activity retention, the following conditions are recommended:

Storage ParameterRecommendation
Long-term storage-20°C to -80°C
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
PreservationAddition of 5-50% glycerol (final concentration)
AliquotingRecommended to avoid repeated freeze-thaw cycles

Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and activity loss . Working aliquots may be stored at 4°C for up to one week .

How can researchers verify the structural integrity of purified MdtI?

Verification of structural integrity and proper folding of purified MdtI can be accomplished through several analytical techniques:

  • SDS-PAGE for size verification and initial purity assessment

  • Western blotting with anti-His antibodies to confirm tag presence

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Size-exclusion chromatography to evaluate oligomeric state

  • Functional assays measuring spermidine export activity in reconstituted liposomes

For membrane proteins like MdtI, verification in a membrane-like environment (such as detergent micelles or liposomes) provides more reliable structural information than assessment in aqueous solutions.

How can spermidine export activity be experimentally measured?

Spermidine export activity of the MdtJI complex can be assessed through several complementary approaches:

  • Growth recovery assays: Monitoring the ability of MdtJI expression to rescue growth in E. coli strains deficient in spermidine acetyltransferase when exposed to high spermidine concentrations .

  • Intracellular spermidine quantification: Measuring the decrease in intracellular spermidine levels in cells expressing MdtJI compared to control cells when cultured in spermidine-containing media .

  • Extracellular spermidine accumulation: Directly measuring the increase in spermidine concentration in the culture medium of cells expressing MdtJI .

  • Radioisotope flux assays: Using radiolabeled spermidine to track export kinetics in whole cells or membrane vesicles.

The combination of these approaches provides robust evidence for MdtJI-mediated spermidine export activity.

What experimental designs are suitable for studying MdtI mutants?

When investigating the effects of MdtI mutations on transport function, researchers should consider the following experimental design elements:

  • Selection of mutation sites: Based on the identified critical residues (Glu5, Glu19, Asp60, Trp68, and Trp81) and conservation analysis across homologs .

  • Mutation types: Consider conservative substitutions (maintaining similar chemical properties) versus non-conservative substitutions to distinguish between structural and functional roles.

  • Expression validation: Verify that mutant proteins are expressed at comparable levels to wild-type and correctly localized to the membrane.

  • Functional assays: Apply the spermidine export measurement methods described above to quantitatively assess the impact of mutations.

  • Complementation analysis: Test if co-expression with wild-type MdtJ can rescue function of MdtI mutants, providing insights into the nature of the MdtJI complex.

How does spermidine concentration affect MdtJI expression and function?

Research has demonstrated that spermidine exposure increases the expression of mdtJI mRNA, suggesting a regulatory feedback mechanism . This relationship can be studied through:

  • Dose-response experiments: Measuring mdtJI mRNA levels after exposure to various spermidine concentrations using quantitative RT-PCR.

  • Time-course analysis: Monitoring the temporal relationship between spermidine exposure and changes in mdtJI expression.

  • Promoter activity assays: Using reporter gene fusions to the mdtJI promoter to quantify transcriptional responses to spermidine.

  • Protein expression correlation: Correlating mRNA levels with actual protein abundance using western blotting or proteomics approaches.

Understanding this regulatory relationship provides insights into how E. coli adapts to changing polyamine levels in its environment.

How does MdtI contribute to bacterial survival under stress conditions?

The MdtJI complex plays a critical role in polyamine homeostasis, which affects multiple aspects of bacterial physiology. Under conditions of elevated spermidine, either from environmental sources or metabolic dysregulation, MdtJI protects cells from polyamine toxicity . This protection mechanism may be particularly important under various stress conditions:

  • Oxidative stress: Polyamines can form toxic conjugates with reactive oxygen species.

  • pH stress: Polyamine protonation varies with pH, affecting their cellular interactions.

  • Osmotic stress: Polyamines influence cell membrane integrity and osmoregulation.

The induction of mdtJI expression by spermidine suggests an adaptive response that helps maintain optimal intracellular polyamine concentrations under changing environmental conditions .

Is MdtI conserved across pathogenic E. coli strains?

While the search results don't provide specific information about MdtI conservation across all pathogenic E. coli strains, the protein has been identified in E. coli O7:K1 , which is associated with neonatal meningitis. The broader context of E. coli genomics suggests that membrane transporters can exhibit variation across strains, particularly in the context of pathogenic adaptations.

What is the relationship between MdtI and bacterial multidrug resistance?

The designation of MdtI as part of the small multidrug resistance (SMR) family suggests potential roles in broader drug resistance mechanisms beyond spermidine export. While the primary characterized function of MdtJI is spermidine export , other members of the SMR family are known to transport various compounds, including antimicrobials.

The potential connection between polyamine transport and antibiotic resistance may involve:

  • Membrane permeability: Changes in polyamine content can affect membrane properties and drug penetration.

  • Cross-substrate recognition: The substrate-binding site of MdtI might accommodate certain antimicrobial compounds.

  • Regulatory overlap: Stress responses that induce mdtJI expression might also induce other resistance mechanisms.

Further research is needed to determine if MdtI directly contributes to antibiotic resistance phenotypes in clinical E. coli isolates.

How can structural biology approaches enhance understanding of MdtI function?

Advanced structural biology techniques would significantly contribute to understanding MdtI function:

  • X-ray crystallography or cryo-EM: Determining the three-dimensional structure of MdtI alone and in complex with MdtJ would reveal the molecular architecture of the transport system and substrate binding sites.

  • Molecular dynamics simulations: Computational modeling of MdtI within a lipid bilayer would provide insights into conformational changes during the transport cycle.

  • Hydrogen-deuterium exchange mass spectrometry: Identifying regions of conformational flexibility and solvent accessibility that might be important for transport function.

  • Single-particle analysis: Examining the structural heterogeneity of the MdtJI complex to identify different conformational states in the transport cycle.

These approaches could reveal the structural basis for spermidine recognition and the transport mechanism of the MdtJI complex.

What are promising strategies for studying MdtI-substrate interactions?

Several experimental approaches can provide insights into how MdtI interacts with spermidine:

  • Binding assays: Using isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to measure direct binding of spermidine to purified MdtI.

  • Photoreactive spermidine analogs: Creating crosslinkable spermidine derivatives that can form covalent bonds with residues in the binding site.

  • Competition assays: Testing whether other polyamines or compounds can compete with spermidine for export, revealing specificity determinants.

  • Tryptophan fluorescence: Monitoring changes in intrinsic fluorescence of the critical tryptophan residues (Trp68, Trp81) upon substrate binding.

  • Site-directed spin labeling: Introducing spin labels at specific positions in MdtI to monitor conformational changes using electron paramagnetic resonance (EPR) spectroscopy.

How might systems biology integrate MdtI function with broader cellular processes?

Understanding MdtI within the broader context of bacterial physiology requires systems-level approaches:

  • Metabolomics: Profiling changes in polyamine-related metabolites in response to mdtJI expression or deletion.

  • Transcriptomics: Identifying genes co-regulated with mdtJI under various conditions to place it within regulatory networks.

  • Protein-protein interaction networks: Determining if MdtI/MdtJ interact with other proteins beyond their direct complex.

  • Flux balance analysis: Incorporating polyamine transport into genome-scale metabolic models to predict systemic effects of MdtI function.

  • Comparative genomics: Analyzing the conservation and co-evolution of mdtI with other genes across bacterial species to infer functional relationships.

These integrative approaches would position MdtI within the complex landscape of bacterial adaptation mechanisms and potentially reveal new therapeutic targets for combating pathogenic E. coli.

What are common challenges in expressing and purifying functional MdtI?

As a membrane protein, MdtI presents several challenges during recombinant expression and purification:

  • Toxicity to expression hosts: Overexpression of membrane proteins can disrupt host cell membrane integrity, leading to growth inhibition or cell death.

  • Protein misfolding and aggregation: Improper membrane insertion can lead to inclusion body formation.

  • Detergent selection: Identifying detergents that efficiently extract MdtI from membranes while maintaining native structure and function.

  • Stability during purification: Preventing denaturation during the multiple steps of chromatographic purification.

  • Functional reconstitution: Transferring purified MdtI into artificial membrane systems that support transport activity.

Researchers should optimize expression conditions (temperature, induction timing, host strain) and consider fusion tags that enhance membrane protein folding and stability.

How can researchers differentiate between MdtI-specific effects and indirect metabolic impacts?

When studying the physiological effects of MdtI expression or deletion, distinguishing direct from indirect effects requires careful experimental design:

  • Complementation controls: Including both wild-type and catalytically inactive mutants of MdtI to distinguish between specific transport activity and non-specific effects.

  • Tight expression control: Using inducible promoters with minimal leakage to create well-defined experimental conditions.

  • Temporal analysis: Monitoring rapid responses that are likely direct effects versus delayed responses that may reflect secondary adaptations.

  • Metabolic profiling: Assessing changes in polyamine-related metabolites and connected pathways to trace the spread of metabolic effects.

  • Genetic background considerations: Testing MdtI effects in strains with different polyamine metabolism gene knockouts to identify context-dependent functions.

What controls are essential for validating MdtI functional assays?

Robust functional characterization of MdtI requires several key controls:

  • Expression verification: Confirming comparable expression levels between wild-type and mutant MdtI constructs through western blotting or fluorescent tagging.

  • Membrane localization: Verifying proper membrane insertion through fractionation studies or fluorescence microscopy with tagged constructs.

  • Substrate specificity: Testing structurally related compounds (other polyamines) and unrelated molecules to confirm transport specificity.

  • Energy dependence: Assessing transport activity under conditions that disrupt the proton motive force to confirm active transport mechanisms.

  • Partner protein dependence: Testing MdtI activity with and without MdtJ co-expression to validate complex formation requirements.

These controls ensure that observed effects can be confidently attributed to MdtI-mediated spermidine export rather than experimental artifacts or indirect effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.