Recombinant Escherichia coli O7:K1 UPF0059 membrane protein yebN (yebN)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O7:K1 UPF0059 Membrane Protein yebN

The UPF0059 membrane protein yebN is found in several Escherichia coli strains, particularly in pathogenic variants like O1:K1 as documented in commercial product databases. This protein belongs to the UPF (Uncharacterized Protein Family) classification, specifically UPF0059, which indicates that while the protein has been identified through genomic and proteomic analyses, its precise biological functions remain largely uncharacterized in scientific literature. The protein's classification as a membrane protein suggests important roles in bacterial membrane integrity, transport processes, or signal transduction mechanisms that may contribute to bacterial survival and virulence.

E. coli K1 strains are particularly significant in clinical microbiology as they are associated with severe neonatal infections including meningitis, with mortality rates ranging between 5% and 50% and many surviving infants experiencing neurological sequelae . These strains have developed sophisticated mechanisms to protect themselves against host immune responses and antibiotics, with membrane proteins playing crucial roles in these defensive strategies. Understanding specialized membrane proteins like yebN in these pathogenic strains is therefore crucial for developing new therapeutic approaches against increasingly antibiotic-resistant bacterial infections.

Protein Classification and Family

The yebN protein is classified within the UPF0059 family, a group of uncharacterized proteins with predicted membrane localization conserved across various bacterial species. The conservation of this protein family across diverse bacterial lineages suggests that these proteins perform important functions in bacterial physiology, despite their specific roles remaining poorly characterized in the scientific literature. Sequence homology and structural prediction analyses may provide insights into potential functions by identifying similarities with better-characterized protein families.

In databases, the protein is identified with the UniProt accession number A1ABY9, providing researchers with standardized access to information about the protein's sequence, predicted structural elements, potential post-translational modifications, and possible functional domains . This cataloging facilitates comparative analyses with related proteins and helps track research developments regarding this protein family.

Gene Location and Organization

In the E. coli O1:K1/APEC strain, the yebN gene is identified with ordered locus name Ecok1_16850 and ORF name APECO1_878 . This genomic annotation provides important context about the gene's organization within the bacterial genome and offers insights into its evolutionary history, regulation patterns, and potential functional associations with neighboring genes. The genomic context may also reveal whether yebN is part of an operon structure, potentially sharing regulatory elements with other genes involved in related cellular processes.

Genomic analyses of pathogenic E. coli strains have revealed considerable diversity in gene content, with many strain-specific regions containing genes that contribute to virulence and host adaptation. The presence and conservation of yebN across multiple E. coli lineages suggest that this protein may serve a fundamental role in bacterial physiology rather than being exclusively associated with pathogenicity.

Conservation Across E. coli Strains

Research has demonstrated that E. coli K1 strains isolated from cerebrospinal fluid can be categorized into at least two distinct groups based on their profiles for putative virulence factors, lipoproteins, proteases, and outer membrane proteins . These different groups employ varying pathogenic mechanisms, with group 2 strains containing open reading frames encoding the type III secretion system apparatus, while group 1 strains predominantly contain ORFs encoding the general secretory pathway . These pathogenic differences may reflect evolutionary adaptations to specific host environments and immune responses.

The distribution and conservation of membrane proteins like yebN across these pathogenic groups remain an area requiring further investigation. Comparative genomic analyses across diverse E. coli isolates could reveal whether yebN exhibits sequence variations correlated with specific pathogenic profiles, potentially providing insights into its role in bacterial adaptation and virulence.

Predicted Membrane Localization

As its classification indicates, yebN is a membrane protein with multiple predicted transmembrane domains. While the specific membrane localization (inner or outer membrane) is not explicitly documented in the available research, the protein's sequence characteristics and predicted structure suggest it is an integral membrane protein likely associated with the bacterial inner membrane. This localization would be consistent with other characterized members of uncharacterized protein families with similar sequence properties.

The protein's membrane topology, including the orientation of its N and C termini and the arrangement of its transmembrane segments, would significantly influence its functional capabilities. The hydrophobic regions in its amino acid sequence likely span the bacterial membrane bilayer, anchoring the protein and potentially forming channels, pores, or binding sites that could facilitate interactions with other cellular components, substrates, or environmental factors.

Potential Functional Roles

While the specific function of yebN remains uncharacterized, membrane proteins in pathogenic E. coli strains typically perform several critical functions that contribute to bacterial survival and virulence. Based on its classification and predicted structure, yebN may participate in:

  • Selective transport of ions or small molecules across the bacterial membrane

  • Signal transduction in response to environmental stimuli

  • Maintenance of membrane integrity under varying conditions

  • Interactions with host cellular components during infection

  • Resistance to antimicrobial agents or toxic compounds

Expression Systems and Purification

Recombinant yebN protein can be produced using established protein expression systems optimized for membrane proteins. Commercial sources offer purified recombinant yebN for research purposes, typically produced through bacterial or eukaryotic expression systems coupled with affinity chromatography purification methods. The expression and purification of membrane proteins like yebN present unique challenges due to their hydrophobic nature, requiring specialized detergents or amphipathic compounds to maintain protein solubility and native conformation during isolation.

The availability of recombinant yebN from commercial suppliers indicates that successful expression and purification protocols have been established, enabling researchers to obtain the protein for structural, functional, and immunological studies. These commercial preparations typically include appropriate tags (although the specific tag type may vary depending on production processes) to facilitate purification while minimizing interference with the protein's native properties .

Relationship to Other UPF Family Proteins

The UPF classification encompasses numerous protein families with unknown or poorly characterized functions. While the specific evolutionary relationships between yebN and other UPF family proteins are not detailed in the available information, comparative analyses of these protein families could provide valuable insights into their evolutionary history, structural conservation, and potential functional similarities. Such analyses might reveal functional clues through identification of conserved sequence motifs or structural elements shared with proteins of known function.

Research on other UPF family proteins has occasionally led to functional characterization, revealing unexpected roles in bacterial physiology and pathogenesis. Similar investigative approaches applied to yebN could potentially uncover its specific cellular functions and significance in bacterial adaptation to diverse environments, including those encountered during host infection.

Similarities and Differences with Known Membrane Proteins

While not directly related to yebN, research on another essential E. coli membrane protein, YejM, provides contextual understanding of bacterial membrane proteins and their functions. YejM is an inner membrane protein with a periplasmic domain that functions as a metalloenzyme with phosphatase activity dependent on magnesium ions . Structural studies have revealed that YejM contains a metal ion binding site conserved across many members of the larger phosphatase superfamily, located at the base of the protein's hydrolase domain .

YejM plays a critical role in outer membrane remodeling, which is essential for bacterial survival during infection . The protein's enzymatic activity appears coupled to changes in outer membrane lipid composition, potentially affecting membrane permeability and resistance to antimicrobial compounds . Although yebN and YejM are distinct proteins, they both represent membrane proteins in pathogenic E. coli strains that may contribute to bacterial fitness and virulence through different mechanisms. Comparative studies of these and other membrane proteins could reveal common structural principles and distinctive functional specializations.

Current Research Utilizing yebN

The commercial availability of recombinant yebN protein facilitates various research applications in bacterial physiology, structural biology, and infectious disease studies. While specific published research utilizing yebN is limited in the available information, potential applications include:

  • Structural studies using X-ray crystallography, cryo-electron microscopy, or nuclear magnetic resonance spectroscopy to determine the protein's three-dimensional conformation

  • Interaction studies to identify binding partners and potential regulatory mechanisms

  • Functional assays to assess potential transport, enzymatic, or signaling activities

  • Development of antibodies for localization and quantification studies

  • Screening for small-molecule inhibitors as potential antimicrobial agents

The uncharacterized nature of yebN presents both challenges and opportunities for researchers investigating the molecular basis of bacterial membrane functions and their contributions to pathogenesis. Novel experimental approaches combining genetic, biochemical, and computational methods could potentially uncover unexpected functions for this conserved membrane protein.

Potential Therapeutic and Biotechnological Applications

Membrane proteins from pathogenic bacteria represent attractive targets for antimicrobial drug development due to their accessibility, essential functions, and often limited similarity to human proteins. As bacterial resistance to conventional antibiotics continues to increase, targeting conserved membrane proteins like yebN could potentially lead to novel therapeutic strategies with reduced susceptibility to existing resistance mechanisms.

Potential applications include:

  • Development of small-molecule inhibitors specifically targeting yebN function

  • Generation of antibodies or peptides that bind to surface-exposed regions of the protein

  • Design of peptidomimetic compounds that interfere with protein-protein interactions

  • Creation of diagnostic tools to identify specific pathogenic E. coli strains

  • Biotechnological applications exploiting the protein's structural or functional properties in engineered systems

As research on bacterial membrane proteins advances, yebN may emerge as a significant target for therapeutic intervention or diagnostic applications, particularly if future studies establish its role in virulence or bacterial survival under stress conditions.

Table 1: Key Properties of Recombinant E. coli UPF0059 Membrane Protein yebN

PropertyDescription
Protein NameUPF0059 membrane protein yebN
SpeciesEscherichia coli O1:K1 / APEC
UniProt AccessionA1ABY9
Gene NameyebN
Ordered Locus NamesEcok1_16850
ORF NamesAPECO1_878
Expression Region1-188
Sequence Length188 amino acids
Storage BufferTris-based buffer, 50% glycerol
Recommended Storage-20°C or -80°C for extended storage; 4°C for up to one week
Protein FamilyUPF0059 (Uncharacterized Protein Family)

Table 2: Comparison of yebN with Other E. coli Membrane Proteins

FeatureyebN (UPF0059)YejM
ClassificationUncharacterized Protein FamilyMetalloenzyme
Known FunctionUncharacterizedPhosphatase activity dependent on magnesium ions
Membrane AssociationMembrane proteinInner membrane protein with periplasmic domain
Role in PathogenesisUnknownCritical role in outer membrane remodeling during infection
StructureFull sequence known, structure uncharacterizedCrystal structure of periplasmic domain solved
Metal BindingUnknownContains a metal ion binding site
Enzymatic ActivityUnknownMagnesium-dependent phosphatase activity

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on multiple factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; yebN; ECIAI39_1231; Probable manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
mntP
Target Protein Sequence
MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGPDDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ ILWTHFHG
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Escherichia coli UPF0059 membrane protein yebN?

The Escherichia coli UPF0059 membrane protein yebN is a relatively small membrane protein consisting of 188 amino acids (1-188aa) as identified in various recombinant expression systems . While classified in the UPF0059 family (Uncharacterized Protein Family 0059), its precise physiological function remains under investigation. Structurally, it contains transmembrane domains characteristic of integral membrane proteins.

The protein has been successfully expressed with N-terminal histidine tags in E. coli expression systems, suggesting compatibility with standard prokaryotic expression platforms . Analysis of its amino acid sequence through bioinformatic approaches indicates potential roles in membrane transport processes, though further experimental validation is required to confirm specific substrates or binding partners.

Functional characterization studies typically employ site-directed mutagenesis of conserved residues to establish structure-function relationships. This methodological approach allows researchers to systematically identify critical domains and amino acid residues essential for the protein's biological activity.

What are the optimal expression conditions for recombinant yebN protein in E. coli?

Optimal expression of recombinant yebN protein in E. coli requires careful consideration of multiple factors to maximize yield while maintaining protein functionality. Based on established protocols, the following conditions have shown effectiveness:

Table 1: Optimal Expression Conditions for Recombinant yebN Protein

ParameterRecommended ConditionsNotes
E. coli StrainBL21(DE3) or Rosetta(DE3)Strains deficient in OmpT and Lon proteases recommended
Expression VectorpET-based with N-terminal His tagAllows IPTG-inducible expression and simplified purification
Temperature18-25°CLower temperatures reduce inclusion body formation
Induction0.1-0.5 mM IPTGLower IPTG concentrations favor proper folding
Growth PhaseMid-log phase (OD600 = 0.6-0.8)Optimal cellular energy state for protein production
MediaEnriched media (e.g., Terrific Broth)Supports higher cell density and protein yield
Expression Time16-24 hoursExtended time at lower temperatures improves yield

Temperature dependence significantly impacts proper folding and membrane integration of yebN, with lower temperatures (18-25°C) generally yielding better results than standard 37°C expression . This is consistent with the behavior of other membrane proteins, where slower expression rates allow proper membrane insertion machinery engagement.

Monte Carlo simulations have demonstrated that optimizing multiple parameters simultaneously through statistical design of experiments yields superior results compared to one-factor-at-a-time approaches . This methodology enables researchers to efficiently identify optimal expression conditions while minimizing experimental runs.

How can I verify the successful expression and purification of recombinant yebN protein?

Verification of successful expression and purification of recombinant yebN protein requires a multi-method approach to confirm both quantity and quality of the target protein. The following methodological workflow is recommended:

  • SDS-PAGE Analysis: Run purified protein samples on 12-15% gels to confirm the expected molecular weight of approximately 20-22 kDa (including the His-tag). For membrane proteins like yebN, migration patterns may appear anomalous due to their hydrophobic nature, often appearing at lower apparent molecular weights than calculated.

  • Western Blotting: Use anti-His antibodies to specifically detect the recombinant protein. This technique provides higher sensitivity than SDS-PAGE alone and confirms the presence of the affinity tag.

  • Mass Spectrometry: Employ LC-MS/MS analysis of tryptic digests to confirm the protein identity based on peptide fragments. This method provides definitive identification even in complex mixtures.

  • Circular Dichroism (CD) Spectroscopy: Assess secondary structure content to verify proper folding, particularly important for membrane proteins like yebN that require specific conformations for function.

  • Functionality Assays: Develop and implement functional assays based on the putative activity of yebN to confirm that the purified protein retains its biological activity.

Quality control procedures should include positive controls with known quantities of histidine-tagged reference proteins to validate detection methods . Additionally, analyzing multiple fractions throughout the purification process helps track protein recovery and identify potential degradation products.

What are the key considerations for designing experiments to study yebN function in different E. coli strains?

Designing robust experiments to study yebN function across different E. coli strains requires careful consideration of multiple variables to ensure reliable and interpretable results. Key methodological considerations include:

  • Strain Selection Strategy: Include both K12 laboratory strains and pathogenic E. coli strains to assess potential functional differences in diverse genetic backgrounds. The GeneChip E. coli Genome 2.0 Array covers approximately 10,000 probe sets for genes present in four strains of E. coli, enabling comprehensive transcriptomic analysis .

  • Genetic Manipulation Approaches: Generate clean deletion mutants (ΔyebN) using λ-Red recombination or CRISPR/Cas9 systems, complemented with plasmid-based expression of wild-type and mutant variants under native or inducible promoters.

  • Phenotypic Characterization Matrix: Systematically assess multiple phenotypes under varying environmental conditions:

Table 2: Phenotypic Characterization Matrix for yebN Studies

Phenotypic CategorySpecific MeasurementsEnvironmental Variables
Growth CharacteristicsGrowth rates, lag times, maximum ODpH, temperature, osmolarity
Stress ResponsesSurvival ratesOxidative, acid, osmotic stress
Membrane IntegrityPermeability assaysMembrane-disrupting agents
Metabolic ProfilingCentral metabolism intermediatesCarbon source variations
Transcriptomic ResponsesDifferential gene expressionGrowth phase, environmental stress
  • Control Implementation: Include appropriate genetic controls (empty vector, unrelated membrane protein expression) and technical replicates (minimum n=3) to ensure statistical validity .

  • Data Integration Strategy: Employ multivariate statistical approaches to correlate phenotypic outcomes with genetic variables and environmental conditions.

This experimental design framework enables systematic investigation of yebN function while controlling for strain-specific effects and environmental variables. Monte Carlo simulations can be employed to assess the robustness of experimental designs and optimize sampling strategies to maximize information gain while minimizing experimental effort .

How should I design model-based experiments for studying kinetic parameters of yebN-mediated transport?

Model-based experimental design (MBDoE) provides a powerful framework for efficiently determining kinetic parameters of yebN-mediated transport processes. This approach optimizes experimental conditions to maximize information content and reduce parameter uncertainty. The following methodological steps are recommended:

Table 3: Comparison of Optimization Criteria for Transport Kinetics Studies

Design CriterionMathematical DefinitionAdvantagesLimitations
D-optimalmax det(FIM)Minimizes volume of confidence region; Scale invariantMay emphasize most sensitive parameters
E-optimalmax λmin(FIM)Reduces parameter correlation; Minimizes worst-case uncertaintyNot a continuous function; May be difficult to optimize
A-optimalmin trace(FIM^-1)Easy to calculate; Minimizes sum of variancesLess effective with high parameter correlation

For membrane proteins like yebN, temperature dependence of transport kinetics is particularly important and can be modeled using modified Arrhenius-type equations . This allows systematic investigation of how temperature affects transport rates and substrate affinities, providing insights into the thermodynamics of the transport process.

What quality control procedures should be implemented when working with recombinant yebN protein?

Implementing rigorous quality control procedures is essential when working with recombinant yebN protein to ensure reproducibility and reliability of experimental results. A comprehensive quality control framework should include:

  • Expression System Validation:

    • Sequence verification of the expression construct

    • Confirmation of strain genotype (especially for specialized expression strains)

    • Validation of induction system functionality with appropriate controls

  • Purification Quality Metrics:

    • Purity assessment through SDS-PAGE and densitometry (target >90% purity)

    • Yield quantification using validated protein assays (BCA or Bradford)

    • Aggregation analysis through dynamic light scattering or size-exclusion chromatography

  • Functional Quality Assessment:

    • Binding affinity measurements for known ligands

    • Activity assays compared to reference standards

    • Stability monitoring through regular activity testing of stored samples

  • Experimental Controls Implementation:

    • Positive controls using reference E. coli strains with known properties

    • Negative controls including uninoculated media controls

    • Tagged reference strains that can be easily distinguished (e.g., fluorescent markers)

  • Documentation Requirements:

    • Detailed record-keeping of all QC results

    • Establishment of acceptance criteria for each test

    • Traceability of reagents and materials

For PCR-based analyses of yebN expression or genetic manipulation, quality control should include DNA template positive controls containing the target sequence and appropriate negative controls to detect contamination . When using specialized detection methods such as the GeneChip E. coli Genome 2.0 Array, following manufacturer-specified quality control procedures ensures reliable detection of yebN transcripts across different E. coli strains .

How can I analyze transcriptomic data to understand yebN regulation in different E. coli strains?

Analyzing transcriptomic data to understand yebN regulation across different E. coli strains requires a structured bioinformatic approach that accounts for strain-specific genetic contexts. The following methodological framework is recommended:

  • Platform Selection and Validation: The GeneChip E. coli Genome 2.0 Array provides comprehensive coverage of approximately 10,000 probe sets for all 20,366 genes present in four strains of E. coli (including K12 and three pathogenic strains) . This platform enables detection of strain-specific regulation patterns through orthologous gene mapping.

  • Experimental Design Considerations:

    • Include biological replicates (minimum n=3) for each strain and condition

    • Implement appropriate normalization controls

    • Consider growth phase effects, as yebN expression may vary across different phases

  • Data Processing Workflow:

    • Quality assessment of raw data (signal intensity distributions, control probe performance)

    • Background correction and normalization (RMA or quantile normalization)

    • Statistical testing for differential expression (moderated t-tests with multiple testing correction)

    • Fold-change thresholding (typically ≥1.5-fold with adjusted p-value <0.05)

  • Integrative Analysis Approaches:

    • Identify co-regulated genes through clustering analysis

    • Perform pathway enrichment analysis to identify biological processes associated with yebN regulation

    • Compare regulatory patterns across strains to identify strain-specific effects

  • Validation Strategy:

    • Confirm key findings with quantitative RT-PCR

    • Correlate transcriptomic data with protein expression levels

    • Validate functional implications through targeted genetic manipulations

For integrating data across multiple strains, it's essential to establish proper orthology relationships between genes, as the GeneChip E. coli Genome 2.0 Array tiles probe sets over the entire open reading frame (ORF) and includes intergenic regions that may contain regulatory elements . This comprehensive coverage enables identification of strain-specific regulatory mechanisms affecting yebN expression.

What statistical approaches are most appropriate for analyzing yebN functional data from multiple experiments?

  • Exploratory Data Analysis:

    • Assess data distributions and identify potential outliers

    • Visualize relationships between variables using scatterplots, boxplots, and correlation matrices

    • Transform data if necessary to meet assumptions of parametric tests (e.g., log transformation for skewed data)

  • Statistical Model Selection:

    • For comparing means across multiple conditions: Analysis of Variance (ANOVA) with appropriate post-hoc tests

    • For dose-response relationships: Regression models with parameter estimation

    • For complex experimental designs: Mixed-effects models to account for random and fixed effects

  • Parameter Estimation Approaches:

    • Maximum likelihood estimation for model parameters

    • Uncertainty quantification through confidence intervals

    • Monte Carlo simulations for robust parameter estimation in non-linear models

  • Advanced Statistical Frameworks:

    • Bayesian approaches for incorporating prior knowledge and updating beliefs based on experimental evidence

    • Multivariate techniques (PCA, clustering) for identifying patterns across multiple variables

    • Meta-analysis methods for integrating results across independent studies

Table 4: Statistical Methods for Different Types of yebN Functional Data

Data TypeRecommended Statistical MethodKey Considerations
Gene ExpressionModerated t-tests with FDR correctionAccount for multiple testing; Minimum sample size n=3
Transport KineticsNon-linear regression (Michaelis-Menten)Consider confidence ellipses for parameter pairs
Growth PhenotypesMixed-effects modelsAccount for batch effects and repeated measures
Protein-Protein InteractionsPermutation testsControl for false discovery in high-throughput datasets
Mutational EffectsANOVA with post-hoc testsInclude appropriate controls for genetic background

For non-linear models commonly used in characterizing transport kinetics (such as Michaelis-Menten models), Monte Carlo simulations provide more accurate representations of parameter uncertainty than linearized approximations based on the Fisher Information Matrix . This approach is particularly valuable when parameters are far from their optimal values or when the model exhibits significant non-linearity.

How can I interpret contradictory results from different experimental approaches studying yebN function?

Interpreting contradictory results from different experimental approaches studying yebN function requires a systematic framework to reconcile discrepancies and develop a coherent understanding. The following methodological approach addresses this challenge:

  • Methodological Reconciliation Strategy:

    • Critically evaluate experimental conditions and methodologies used in each study

    • Identify key differences in experimental design that might explain discrepancies

    • Consider strain-specific effects, as yebN function may vary across the four E. coli strains represented in comprehensive arrays

  • Hierarchical Evidence Assessment:

    • Evaluate the quality of evidence using pre-defined criteria (sample size, replication, controls)

    • Consider the specificity and sensitivity of each experimental approach

    • Assign different weights to evidence based on methodological rigor

  • Context-Dependent Interpretation Framework:

    • Recognize that apparently contradictory results may represent context-dependent functions

    • Develop hypotheses about conditional factors that might explain different outcomes

    • Design validation experiments specifically targeting these conditional factors

  • Integrative Modeling Approach:

    • Develop mathematical models that can accommodate seemingly contradictory results

    • Use parameter estimation techniques with Monte Carlo simulations to identify parameter regimes consistent with all observations

    • Validate model predictions with targeted experiments

  • Collaborative Resolution Process:

    • Engage with researchers using different approaches

    • Standardize protocols to eliminate methodological variations

    • Perform side-by-side comparisons under identical conditions

When contradictory results arise from studies using different E. coli strains, it's important to consider strain-specific genetic contexts. The GeneChip E. coli Genome 2.0 Array can be valuable for identifying strain-specific genetic elements that might influence yebN function . Additionally, applying Monte Carlo simulations allows researchers to identify parameter spaces where apparently contradictory results might be reconciled within a unified mathematical framework .

How can yebN be used as a model system for studying membrane protein topology and folding?

The E. coli membrane protein yebN offers an excellent model system for investigating fundamental aspects of membrane protein topology and folding due to its moderate size (188 amino acids) and amenability to recombinant expression . The following methodological approaches leverage yebN for advancing membrane protein structural biology:

  • Topology Mapping Strategies:

    • Cysteine scanning mutagenesis: Systematically introduce cysteine residues and assess their accessibility to membrane-impermeable reagents

    • Reporter fusion approach: Create fusion constructs with topology-reporting domains (PhoA/LacZ) at different positions

    • Epitope insertion: Introduce epitope tags at predicted loops and termini for antibody accessibility studies

  • Folding Pathway Investigation:

    • Pulse-chase experiments with synchronized translation

    • Time-resolved crosslinking to capture folding intermediates

    • Temperature-sensitive folding mutants to isolate specific folding steps

  • Integrative Structural Approaches:

    • Cryo-electron microscopy for near-atomic resolution structures

    • Solid-state NMR for dynamic structural information

    • Molecular dynamics simulations constrained by experimental data

  • Engineering and Design Applications:

    • Rational design of topology-altered variants

    • Chimeric constructs with other membrane proteins

    • Directed evolution for enhanced stability or altered topology

The well-characterized expression system for yebN, utilizing N-terminal His tags in E. coli , provides a reliable platform for generating sufficient quantities of protein for these studies. Temperature-dependent expression optimization, as informed by Monte Carlo simulation approaches , enables fine-tuning of conditions to maximize properly folded protein yield.

For structural studies, integrating data from multiple experimental techniques provides more robust models than any single approach. Statistical analysis of parameter uncertainty, as demonstrated in model-based experimental design approaches , can be applied to structural model refinement to quantify confidence in different structural features.

What advanced genome editing approaches can be used to study yebN function in pathogenic E. coli strains?

Studying yebN function in pathogenic E. coli strains requires sophisticated genome editing approaches that maintain strain-specific genetic contexts while enabling precise manipulation. The following methodological framework outlines advanced approaches for this research:

  • CRISPR/Cas9-Based Editing Strategies:

    • Single-nucleotide precision mutagenesis to introduce point mutations

    • Scarless deletion of yebN with minimal disruption to surrounding genetic elements

    • Allelic replacement to swap variants between strains

    • CRISPRi for conditional repression without permanent genetic changes

  • Recombineering Approaches:

    • λ-Red recombineering for marker-free modifications

    • Multiplex automated genome engineering (MAGE) for introducing variations across multiple sites

    • Conjugative assembly genome engineering (CAGE) for large-scale genome restructuring

  • Selection and Screening Methodologies:

    • Dual selection systems to increase editing efficiency

    • FACS-based enrichment of successfully edited cells

    • Deep sequencing validation of edited populations

  • Strain-Specific Considerations:

    • Optimization of transformation protocols for pathogenic strains

    • Adaptation of selection markers for different genetic backgrounds

    • Validation of editing efficiency across the four strains covered by GeneChip E. coli arrays

  • Functional Validation Strategies:

    • Complementation testing with wild-type and mutant variants

    • Multi-omics profiling of edited strains

    • Phenotypic characterization under various environmental conditions

When working with pathogenic strains, appropriate biosafety measures and regulatory compliance are essential. For functional studies across multiple strains, the GeneChip E. coli Genome 2.0 Array provides a valuable platform for comprehensive transcriptomic analysis, as it includes probe sets for all genes present in four strains of E. coli, including both K12 and pathogenic variants .

Quality control for genome editing should follow principles outlined for experimental controls in microbiological research, including appropriate positive and negative controls at each step of the editing process . Validation of edits should employ multiple methods, including sequencing and functional assays, to ensure the specificity and completeness of the intended modifications.

How can computational modeling enhance our understanding of yebN structure-function relationships?

Computational modeling provides powerful tools for exploring yebN structure-function relationships, enabling hypotheses generation and experimental design optimization. The following methodological framework outlines advanced computational approaches for yebN research:

  • Structural Modeling Pipeline:

    • Homology modeling based on structurally characterized UPF0059 family members

    • Ab initio modeling for regions lacking structural templates

    • Membrane embedding simulation using implicit or explicit membrane models

    • Refinement with molecular dynamics simulations in lipid bilayer environments

  • Molecular Dynamics Applications:

    • Conformational dynamics analysis to identify potential functional states

    • Lipid-protein interaction mapping to identify boundary lipid preferences

    • Water/ion permeation studies to characterize potential transport pathways

    • Free energy calculations for ligand binding and ion translocation

  • Integrated Computational-Experimental Approach:

    • Virtual screening for potential ligands or inhibitors

    • Simulation-guided mutagenesis to test computational predictions

    • Ensemble-based modeling incorporating experimental constraints

    • Parameter estimation using Monte Carlo methods to reconcile computational and experimental data

  • Systems Biology Integration:

    • Network analysis to identify functional associations

    • Flux balance analysis to predict metabolic impacts of yebN mutations

    • Multi-scale modeling connecting molecular events to cellular phenotypes

Table 5: Computational Methods for Different Aspects of yebN Research

Research AspectComputational MethodsExperimental Validation Approaches
Structure PredictionHomology modeling, MD simulationsCysteine crosslinking, EPR spectroscopy
Ligand BindingMolecular docking, free energy calculationsBinding assays, mutagenesis studies
Transport MechanismSteered MD, umbrella samplingTransport assays with structure-guided mutants
Evolutionary AnalysisSequence conservation mapping, coevolution analysisFunctional testing of conserved residues
Expression RegulationPromoter analysis, transcription factor binding predictionReporter assays, ChIP-seq validation

For robust computational modeling, incorporating uncertainty quantification through Monte Carlo simulations provides a more realistic assessment of prediction confidence . This approach is particularly valuable when experimental data is limited or ambiguous, allowing researchers to identify the range of structural models consistent with available data rather than committing to a single model prematurely.

Computational predictions should be systematically validated through targeted experiments, creating an iterative cycle of prediction and validation that progressively refines understanding of yebN structure-function relationships.

What ethical considerations should be addressed when designing experiments with recombinant E. coli strains expressing yebN?

Designing experiments with recombinant E. coli strains expressing yebN requires careful attention to ethical considerations that extend beyond standard laboratory safety protocols. The following methodological framework addresses these considerations:

  • Biosafety Evaluation Framework:

    • Risk assessment based on strain pathogenicity (particularly for O7:K1 strains)

    • Containment level determination according to institutional and regulatory guidelines

    • Genetic stability assessment to prevent unintended modifications or transfers

    • Implementation of biological and physical containment measures

  • Dual-Use Research Potential:

    • Evaluation of knowledge generated for potential misuse

    • Implementation of responsible publication practices

    • Consultation with institutional biosafety committees for sensitive research

  • Environmental Impact Considerations:

    • Proper decontamination and disposal procedures

    • Use of biological containment strategies (auxotrophic strains)

    • Assessment of horizontal gene transfer potential

    • Compliance with environmental protection regulations

  • Research Justification and Alternatives:

    • Clear articulation of scientific merit and potential benefits

    • Consideration of alternative approaches with reduced risks

    • Application of the 3Rs principle (Replacement, Reduction, Refinement)

    • Ensuring that experiments are designed to maximize information gain

  • Inclusive Research Practices:

    • Ensuring research benefits diverse populations

    • Addressing potential healthcare inequities resulting from research

    • Avoiding sampling bias that might limit generalizability

When working with pathogenic E. coli strains, researchers must be particularly vigilant about containment and decontamination procedures. The GeneChip E. coli Genome 2.0 Array, which covers genes from both K12 and pathogenic strains , enables comparative studies without necessarily handling viable pathogenic organisms for all experiments.

For optimal experimental design that maximizes information while minimizing risk, Monte Carlo simulation approaches can be employed to identify experimental conditions that provide the greatest statistical power with the fewest experimental runs or lowest risk level . This approach aligns with ethical principles of minimizing potential harm while maximizing scientific benefit.

How should researchers address reproducibility challenges in complex experiments with yebN protein?

Addressing reproducibility challenges in complex experiments with yebN protein requires systematic approaches to experimental design, documentation, and validation. The following methodological framework promotes robust and reproducible research:

  • Standardized Protocol Development:

    • Detailed step-by-step procedures with precise specifications

    • Identification and control of critical parameters affecting outcomes

    • Validation across different laboratory settings

    • Implementation of automated procedures where possible

  • Comprehensive Reporting Standards:

    • Complete materials description (strain designations, plasmid maps, reagent sources)

    • Detailed methods reporting following community standards

    • Raw data preservation and accessibility

    • Transparent reporting of both successful and failed approaches

  • Statistical Design and Analysis Framework:

    • A priori power analysis to determine appropriate sample sizes

    • Pre-registration of experimental designs and analysis plans

    • Robust statistical methods appropriate for the data structure

    • Monte Carlo simulations to assess parameter uncertainty in complex models

  • Validation and Replication Strategy:

    • Internal validation through technical and biological replicates

    • External validation through independent methods

    • Collaborative verification with other laboratories

    • Systematic comparison with published results

  • Quality Control Implementation:

    • Inclusion of appropriate positive and negative controls

    • Use of reference standards for quantitative measurements

    • Regular calibration and maintenance of equipment

    • Authentication of key biological materials

The complexity of membrane protein research presents particular challenges for reproducibility. Temperature-dependent effects on protein folding and function require careful control and documentation of experimental conditions . Statistical approaches like Monte Carlo simulations provide robust methods for parameter estimation in complex models, accounting for inherent biological variability and measurement uncertainty .

For transcriptomic studies using platforms like the GeneChip E. coli Genome 2.0 Array , standardized quality control procedures and data processing pipelines are essential for ensuring reproducibility across different laboratories and experimental conditions.

What are the future research directions for understanding yebN function in E. coli?

The study of recombinant Escherichia coli O7:K1 UPF0059 membrane protein yebN represents an evolving field with several promising research directions. Future investigations will likely focus on integrating structural insights with functional characterization across different E. coli strains. Key research trajectories include:

  • Structural Biology Advancements: Application of emerging technologies such as cryo-electron microscopy and integrative structural biology approaches will provide higher resolution insights into yebN's membrane topology and dynamic conformational changes. These structural studies will benefit from optimized expression systems using N-terminal His tags already established for this protein .

  • Systems Biology Integration: Placing yebN function within broader cellular networks through multi-omics approaches will reveal its role in cellular physiology. The GeneChip E. coli Genome 2.0 Array, which covers approximately 10,000 probe sets for genes from four E. coli strains , provides a valuable platform for transcriptomic studies examining yebN's regulatory networks.

  • Comparative Genomics and Evolution: Exploring yebN homologs across bacterial species will illuminate evolutionary conservation and specialization. This comparative approach may reveal strain-specific adaptations in pathogenic versus non-pathogenic E. coli variants.

  • Methodological Innovations: Development of advanced biophysical techniques for membrane protein characterization will enhance our understanding of yebN dynamics. Monte Carlo simulation approaches for experimental design optimization will continue to improve the efficiency and information yield of complex membrane protein studies.

  • Translational Applications: Investigating yebN as a potential antimicrobial target or biotechnological tool represents an unexplored frontier. Structure-based drug design targeting bacterial-specific features of yebN may lead to novel antimicrobial strategies.

The integration of computational modeling with experimental validation will be particularly important, with Monte Carlo simulations providing robust methods for uncertainty quantification in complex biological systems . This integrated approach will enable researchers to develop more accurate models of yebN function and its contribution to bacterial physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.