Recombinant Escherichia coli O7:K1 UPF0114 protein YqhA (yqhA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yqhA; ECIAI39_3498; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
yqhA
Target Protein Sequence
MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should recombinant YqhA protein be stored for optimal stability?

For optimal stability, recombinant YqhA protein should be stored according to these guidelines:

  • Long-term storage: -20°C or -80°C (preferred for extended storage)

  • Working aliquots: 4°C for up to one week

  • Storage buffer composition: Either Tris-based buffer with 50% glycerol or Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Important note: Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity

For reconstitution from lyophilized form:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (usually 50% is recommended) for long-term storage

What are the common expression systems used for producing recombinant YqhA?

E. coli is the predominant expression system used for producing recombinant YqhA protein. The recombinant protein is typically expressed with fusion tags to facilitate purification and detection:

  • Expression host: E. coli (various strains)

  • Common fusion tags: His-tag (particularly N-terminal His tags)

  • Expression region: Full-length protein (amino acids 1-164)

  • Purification approach: Affinity chromatography utilizing the fusion tag

  • Protein purity: Typically >90% as determined by SDS-PAGE

E. coli remains the system of choice due to its well-established protocols, cost-effectiveness, and high yield potential for bacterial proteins .

What homologs of YqhA exist in other bacterial species?

YqhA belongs to the UPF0114 protein family with homologs present in several bacterial species:

OrganismProtein IdentifierSequence SimilarityNotable Differences
Salmonella typhiUPF0114 protein YqhA (STY3326, t3074)High similarityContains amino acid substitutions: E→V at position 5, I→L at position 26, S→A at position 36, V→I at position 41, and more
Salmonella enterica subsp. enterica serovar Paratyphi AUPF0114 protein YqhA (Q5PMS0)High similarityStructure predicted by AlphaFold with 89.45% confidence score
Escherichia coli O9:H4 (strain HS)UPF0114 protein YqhANearly identicalHighly conserved sequence to O7:K1 strain
E. coli K-12UPF0114 protein YqhAHigh similarityPart of the "y-ome" (genes lacking experimental evidence of function)

The high conservation across different species suggests an important, yet uncharacterized function.

What methodological approaches can be used to investigate the function of YqhA?

Several experimental approaches can be employed to elucidate YqhA's function:

Genetic Approaches:

  • Gene knockout studies: Create yqhA deletion mutants and assess phenotypic changes

  • Complementation analysis: Reintroduce yqhA in knockout strains to confirm function

  • Long-term evolution experiments: Monitor how yqhA evolves under different selective pressures, similar to Lenski's E. coli LTEE methodology

Expression Analysis:

  • RNA-seq analysis under different growth conditions to identify co-regulated genes

  • Proteomics analysis to determine protein-protein interactions

  • Reporter gene fusions to study promoter activity and regulation

Structural Biology:

  • Membrane protein crystallization for precise structural determination

  • Cryo-EM to visualize the protein in its native membrane environment

  • Comparison with AlphaFold models to identify functional domains

Functional Assays:

  • Membrane integrity tests in wildtype vs. knockout strains

  • Stress response assays to determine role in bacterial adaptation

  • Transport assays to test potential transporter function

How can codon optimization improve recombinant YqhA expression?

Codon optimization can significantly impact the expression level of recombinant YqhA:

Key principles for E. coli expression optimization:

  • Analysis of the yqhA nucleotide sequence reveals that expression can be enhanced through selective codon optimization

  • Focus on codons for amino acids that are most utilized in YqhA (Leu, Ala, Val)

  • Select codons that are read by tRNAs that are most highly charged during amino acid starvation rather than simply using the most abundant codons

A study on synthetic gene design in E. coli found that protein production levels could vary from undetectable to 30% of cellular protein based solely on synonymous codon usage . For YqhA expression, special attention should be given to codons for Gly, Leu, Asp, Glu, Tyr, and Ala, as these were identified as critical for modeling expression levels .

Codon Adaptation Index (CAI) calculation for yqhA and subsequent optimization can be performed using algorithms that consider:

  • E. coli codon bias

  • mRNA secondary structure prevention

  • GC content balancing

  • Removal of potential regulatory sequences that might inhibit expression

What is currently known about YqhA's role in E. coli O7:K1 pathogenicity?

While the specific function of YqhA in E. coli O7:K1 remains undetermined, contextual information suggests potential involvement in pathogenicity:

  • E. coli O7:K1 is an extraintestinal pathogenic E. coli (ExPEC) strain that can cause serious infections

  • A related serotype, E. coli O7:H4, was implicated in a large-scale food poisoning outbreak in Japan in 2020, though this strain lacked well-characterized virulence genes other than astA

  • YqhA, being a transmembrane protein, may potentially be involved in:

    • Membrane integrity maintenance during host infection

    • Transport of nutrients or virulence factors

    • Signaling processes important for pathogenicity

    • Stress response during host-pathogen interaction

  • E. coli O157:H7, another pathogenic strain, utilizes multiple membrane proteins for attachment and virulence . Comparative studies between these strains might reveal functional similarities with YqhA.

Further investigation using infection models and comparison with non-pathogenic E. coli strains is needed to establish YqhA's specific role in pathogenicity.

How does YqhA fit into the "y-ome" of E. coli and what methodologies are employed to study such proteins?

YqhA belongs to the "y-ome" of E. coli - a term for genes lacking experimental evidence of function with a mechanism for affecting cell phenotype. The y-ome comprises approximately 35% (1600 of 4623) of unique E. coli genes . Methodological approaches to study such poorly characterized proteins include:

  • Systematic functional annotation:

    • Integrating information from multiple knowledge bases (EcoCyc, EcoGene, UniProt, RegulonDB)

    • Using controlled vocabulary and evidence codes to track annotation progress

    • Prioritizing genes based on conservation and potential importance

  • Expression pattern analysis:

    • RNA-seq data analysis under varied conditions to identify expression patterns

    • The y-ome genes tend to have lower expression levels than well-characterized genes

    • YqhA expression can be monitored in nutrient-limited conditions (glucose vs. ammonia limitation)

  • Genomic context analysis:

    • Examining gene neighborhood for functional clues

    • The y-ome genes are enriched in the termination region of the E. coli chromosome

  • Evolutionary analysis:

    • Studying conservation across species to infer importance

    • Using approaches similar to the E. coli long-term evolution experiment to track mutations

What purification protocols yield high-purity recombinant YqhA suitable for structural studies?

Obtaining high-purity YqhA for structural studies requires specialized protocols due to its transmembrane nature:

Recommended purification protocol:

  • Expression optimization:

    • Use E. coli BL21(DE3) or similar strain with membrane protein expression capacity

    • Express with N-terminal His-tag for affinity purification

    • Consider using specialized vectors designed for membrane protein expression

  • Cell lysis and membrane fraction isolation:

    • Gentle cell disruption methods (e.g., French press or sonication)

    • Differential centrifugation to isolate membrane fractions

    • Careful buffer selection to maintain membrane protein stability

  • Detergent solubilization:

    • Screen detergents (DDM, LDAO, etc.) for optimal solubilization

    • Maintain protein in solubilized state throughout purification

  • Affinity chromatography:

    • IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA or similar resin

    • Gradual imidazole gradient for elution to separate non-specific binding proteins

  • Size exclusion chromatography:

    • Final polishing step to achieve >95% purity

    • Buffer containing appropriate detergent concentration

  • Quality control:

    • SDS-PAGE analysis to confirm purity (aim for >90%)

    • Mass spectrometry to verify protein identity

    • Dynamic light scattering to assess homogeneity

For crystallography studies, consider:

  • Detergent screening for crystal formation

  • Lipidic cubic phase methods for membrane protein crystallization

  • Tag removal using TEV protease if the tag interferes with crystallization

What experimental designs can be used to study YqhA expression under different stress conditions?

To investigate YqhA expression under different stress conditions, consider the following experimental design approaches:

1. Chemostat-based expression studies:

  • Establish steady-state growth in glucose-limited or ammonia-limited chemostat cultures

  • Maintain constant growth rate (e.g., 0.10 h⁻¹) while varying nutrient limitation

  • Extract RNA for global transcriptional analysis including yqhA

2. Environmental stress panel:

  • Expose E. coli cultures to various stressors:

    • Osmotic stress (NaCl gradient)

    • pH stress (acidic and alkaline conditions)

    • Oxidative stress (H₂O₂ exposure)

    • Antibiotic sub-inhibitory concentrations

    • Temperature stress (heat shock/cold shock)

  • Monitor YqhA expression through qRT-PCR or reporter gene fusion

3. Host-relevant conditions simulation:

  • Mimic host environment conditions:

    • Serum exposure

    • Iron limitation

    • Bile salts exposure

    • Macrophage internalization

  • Compare expression between pathogenic and non-pathogenic strains

4. Molecular reporter systems:

  • Create transcriptional/translational fusions:

    • yqhA promoter-GFP fusion for transcriptional analysis

    • yqhA-fluorescent protein fusion for localization studies

  • Use flow cytometry for single-cell level expression analysis

5. Differential expression analysis:

  • Perform RNA-seq comparing wildtype and regulatory mutants

  • Analyze data using established bioinformatics pipelines to identify:

    • Co-expressed genes

    • Regulatory networks

    • Expression patterns shared with genes of known function

This experimental framework allows systematic characterization of YqhA expression patterns, potentially revealing functional insights based on the conditions that induce or repress its expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.