Recombinant Escherichia coli O7:K1 UPF0208 membrane protein YfbV (yfbV)

What is the YfbV protein and what are its key structural features?

YfbV is a UPF0208 family membrane protein found in Escherichia coli O7:K1 with 151 amino acids. The protein structure has been computationally modeled with a global pLDDT (predicted Local Distance Difference Test) score of 81.8, indicating a confident model, though this remains unverified by experimental data . The amino acid sequence is: MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPFVENRVIKMTRYAIRFMPPIAVFTLCWQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVLAPVEGKPDYQALADTLKRAFKQLDKTFLDDL . This membrane protein contains regions of varying confidence in the structural model, with some segments showing very high confidence (pLDDT > 90) and others with lower confidence scores, potentially indicating flexible regions .

How is YfbV classified and what functional domains does it contain?

YfbV is classified as a UPF0208 membrane protein and is also known by synonyms ECIAI39_2442 and yfbV . Based on its classification and sequence similarities to other proteins, YfbV likely contains membrane-spanning domains that are crucial for its integration into the bacterial cell membrane. While specific functional domains have not been explicitly identified in the available search results, the computational modeling suggests a predominantly helical structure typical of membrane proteins .

What are the optimal expression conditions for recombinant YfbV protein?

The expression of membrane proteins like YfbV requires careful optimization of growth conditions. Research indicates that the most rapid growth conditions are not necessarily optimal for membrane protein production . For recombinant YfbV specifically, expression in E. coli has been demonstrated using an N-terminal His-tag fusion approach . Critical factors to consider include:

• Growth phase: Cells should be harvested prior to glucose exhaustion, just before the diauxic shift

• Temperature: Lower temperatures (typically 16-30°C) often yield better folding for membrane proteins

• Inducer concentration: Optimal IPTG concentration should be determined empirically

• Media composition: Rich media versus minimal media affects protein yield and quality

The growth conditions should be tightly controlled in high-performance bioreactors to ensure reproducibility and optimal protein yields .

What purification strategies are most effective for YfbV?

Purification of YfbV can be approached through affinity chromatography utilizing the N-terminal His-tag . A systematic purification strategy includes:

• Cell lysis in appropriate buffer conditions

• Membrane fraction isolation through differential centrifugation

• Solubilization of membrane proteins using suitable detergents

• Immobilized metal affinity chromatography (IMAC) for His-tagged protein capture

• Size exclusion chromatography for further purification and buffer exchange

The purified protein shows greater than 90% purity as determined by SDS-PAGE analysis . Reconstitution of the lyophilized protein should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and addition of 5-50% glycerol is recommended for long-term storage .

How can vesicle-based expression systems enhance YfbV production?

Recent innovations in protein expression technology include vesicle-packaged recombinant protein production systems, which could be applied to challenging membrane proteins like YfbV. These systems export diverse recombinant proteins in membrane-bound vesicles from E. coli, providing a microenvironment that enables production of insoluble, toxic, or disulfide-bond containing proteins .

For YfbV application, this approach has several potential advantages:

• Compartmentalization of the protein within a natural lipid environment

• Potential for higher functional yields compared to traditional methods

• Improved protein stability and storage capabilities

• Reduced toxicity to the host cells during expression

Implementing a VNp fusion tag strategy has demonstrated enhanced expression of target proteins with yields approaching 1g soluble protein/liter in shake flask cultures for some proteins . This approach could be particularly valuable for YfbV if traditional expression methods yield insufficient amounts of functional protein.

What structural biology techniques are most appropriate for YfbV characterization?

While computational models of YfbV exist , experimental structural determination remains valuable. The following techniques may be applied for comprehensive structural characterization:

The confidence levels from the AlphaFold model (pLDDT scores) can guide these experimental approaches by identifying regions of high confidence versus those requiring further validation .

What assays can determine if YfbV has glycan-binding properties similar to other membrane proteins?

Given that some bacterial membrane proteins exhibit glycan-binding properties, such as YtfB binding to N'acetylglucosamine and mannobiose structures , investigating similar properties in YfbV would be valuable. Methodological approaches include:

• Glycan array screening: Utilizing a panel of distinct glycan structures to identify potential binding interactions

• Surface plasmon resonance (SPR): Measuring binding kinetics and affinity of YfbV to immobilized glycans

• Isothermal titration calorimetry (ITC): Determining thermodynamic parameters of binding

• Fluorescence polarization assays: Detecting protein-glycan interactions in solution

• Pull-down assays with glycosylated substrates: Identifying specific binding partners

These approaches should be conducted with purified YfbV protein and compared with appropriate controls to establish specificity of any observed interactions.

How can researchers investigate potential roles of YfbV in bacterial pathogenicity?

Based on sequence similarities between some membrane proteins and virulence factors , YfbV might have functions relevant to pathogenicity. To investigate this possibility:

• Gene knockout studies: Create yfbV deletion mutants and assess impact on virulence in appropriate models

• Adhesion assays: Evaluate if YfbV influences bacterial adhesion to epithelial cells

• Protein-protein interaction studies: Identify potential interactions with known virulence factors

• Host cell response assessment: Measure host immune responses to wild-type versus yfbV mutant bacteria

• In vivo infection models: Compare colonization and infection dynamics between wild-type and mutant strains

These approaches would help determine whether YfbV contributes to bacterial pathogenicity and identify its specific role in host-pathogen interactions.

What methods can elucidate the membrane topology of YfbV?

Understanding the membrane topology of YfbV is crucial for functional characterization. Several complementary approaches can be employed:

• Protease accessibility assays: Determining exposed versus protected regions

• Cysteine scanning mutagenesis: Introducing cysteine residues at various positions and probing their accessibility

• Fluorescence quenching experiments: Measuring the depth of specific residues within the membrane

• Computational prediction tools: Utilizing algorithms designed for membrane protein topology prediction

• Cryo-EM of membrane-embedded protein: Visualizing the protein within its native lipid environment

The AlphaFold model provides initial insights into the structure but experimental validation of membrane orientation remains essential .

How can researchers study potential oligomerization of YfbV in membranes?

Membrane proteins often function as oligomers. To investigate YfbV oligomerization:

• Blue native PAGE: Separating native protein complexes to identify oligomeric states

• Chemical cross-linking followed by mass spectrometry: Capturing and identifying interacting regions

• Fluorescence resonance energy transfer (FRET): Detecting proximity between labeled protein molecules

• Analytical ultracentrifugation: Determining oligomeric states in detergent solutions

• Single-molecule tracking in membranes: Observing dynamic associations in near-native conditions

These approaches should be combined with functional assays to correlate oligomerization with specific activities of YfbV.

How can growth conditions be optimized for maximal functional YfbV yield?

Membrane protein production is recognized as a primary bottleneck in structural genomics programs . For YfbV, optimization should include:

• Systematic bioreactor parameter testing: Evaluating temperature, pH, dissolved oxygen, and nutrient feeding strategies

• Harvest timing optimization: Cells should be harvested prior to glucose exhaustion, just before the diauxic shift

• Analysis of gene expression patterns: Monitoring expression levels of genes involved in membrane protein secretion

• Strain engineering: Modifying host cells to enhance membrane protein production machinery

• Induction strategy optimization: Testing various inducer concentrations and induction timing

The optimization process should involve carefully controlled growth conditions in high-performance bioreactors and systematic quantification of culture parameters .

What are the critical factors in scaling up YfbV production for structural studies?

Scaling up membrane protein production requires addressing several challenges:

Research indicates that the most rapid growth conditions are not necessarily optimal for membrane protein production, and careful monitoring of culture parameters is essential .

What are the optimal storage conditions for purified YfbV protein?

For purified YfbV protein, the following storage recommendations apply:

• Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use

• Avoid repeated freeze-thaw cycles

• Working aliquots can be stored at 4°C for up to one week

• For reconstitution, add glycerol to a final concentration of 5-50% (with 50% being the default recommendation)

• Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0 as a storage buffer

These conditions help maintain protein stability and activity during storage periods.

How can vesicle-based systems improve long-term stability of YfbV?

Vesicle-packaged recombinant proteins offer advantages for long-term storage of active protein . For YfbV applications:

• Recombinant vesicles can compartmentalize the protein within a protective lipid environment

• This approach maintains the native membrane context, potentially preserving function

• Vesicles may protect against proteolytic degradation and oxidation

• Lyophilization of vesicle preparations can be explored for room-temperature storage

• Activity assays should be performed before and after storage to validate preservation of function

This approach could be particularly valuable for maintaining the functional integrity of membrane proteins like YfbV during extended storage periods .

What approaches can identify potential interaction partners of YfbV?

To identify proteins that interact with YfbV:

• Affinity purification coupled with mass spectrometry (AP-MS): Pulling down YfbV complexes and identifying associated proteins

• Bacterial two-hybrid screening: Systematic testing of protein-protein interactions

• Co-immunoprecipitation with antibodies against YfbV: Capturing in vivo interaction partners

• Proximity labeling methods (BioID or APEX): Identifying proteins in close proximity to YfbV in living cells

• Computational predictions: Using tools like STRING to predict potential interaction networks

These approaches should be validated through multiple methods to confirm genuine interactions versus experimental artifacts.

How can researchers investigate the role of YfbV in cellular physiology?

To study YfbV's physiological roles:

• Gene deletion and complementation studies: Creating yfbV knockout strains and assessing phenotypic changes

• Controlled expression systems: Studying effects of YfbV under- and overexpression

• Transcriptomic analysis: Examining gene expression changes in response to YfbV manipulation

• Metabolomic profiling: Identifying metabolic pathways affected by YfbV modification

• Stress response assays: Testing sensitivity to various stressors in wild-type versus mutant strains

These investigations should be performed under various growth conditions to comprehensively characterize YfbV function.