Recombinant Escherichia coli O7:K1 UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Description

Functional Role

YciC is implicated in:

  • Zinc Homeostasis: Regulated by Zur (zinc uptake regulator) under zinc-sufficient conditions . Binds zinc ions via conserved cysteine residues, acting as a metallochaperone .

  • Membrane Protein Insertion: Homologs interact with YidC, a membrane insertase facilitating co-translational integration of transmembrane proteins .

  • Pathogenicity: While not directly studied in E. coli O7:K1, YciC’s structural homologs in Salmonella and Bacillus subtilis suggest roles in stress response and metal ion trafficking during infection .

Production and Purification

Recombinant YciC is produced under optimized conditions:

  • Expression: Full-length yciC cloned into E. coli vectors (e.g., pET systems) with IPTG induction .

  • Purification: Nickel-affinity chromatography yields >90% purity (SDS-PAGE verified) .

  • Storage: Lyophilized in Tris/PBS buffer (pH 8.0) with 6% trehalose; stable at -80°C .

Reconstitution Guidelines:

  1. Centrifuge lyophilized powder to collect contents.

  2. Resuspend in sterile water (0.1–1.0 mg/mL).

  3. Add glycerol (5–50%) for long-term storage .

Research Applications

  • Structural Studies: Used in crystallography and cryo-EM to resolve membrane protein insertion mechanisms .

  • Metal Ion Trafficking: Investigated for its role in zinc redistribution under stress .

  • Vaccine Development: Membrane proteins like YciC are potential targets for antisera or monoclonal antibody production .

Key Research Findings

  • Regulatory Mechanism: In Bacillus subtilis, yciC repression requires two Zur-binding sites (C1 and C2), highlighting evolutionary conservation of zinc-responsive regulation .

  • Interaction with Ribosomes: YidC, a partner insertase, binds ribosomes near tunnel exits to facilitate co-translational membrane insertion—a process YciC may modulate .

  • Biophysical Stability: Molecular dynamics simulations show YciC’s hydrophobic core stabilizes interactions with lipid bilayers, while polar residues mediate cytoplasmic interactions .

Unresolved Questions

  • Does YciC directly interact with YidC in E. coli O7:K1?

  • What specific metalloenzymes does YciC assist in E. coli?

  • How does YciC contribute to the pathogenicity of ExPEC strains?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes. We will do our best to fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments default to standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
yciC; ECIAI39_1592; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
yciC
Target Protein Sequence
MSITAQSVYRDTGNFFRNQFMTILLVSLLCAFITVVLGHVFSPSDAQLAQLNDGVPVSGS SGLFDLVQNMSPEQQQILLQASAASTFSGLIGNAILAGGVILIIQLVSAGQRVSALRAIG ASAPILPKLFILIFLTTLLVQIGIMLVVVPGIIMAILLALAPVMLVQDKMGVFASMRSSM RLTWANMRLVAPAVLSWLLAKTLLLLFASSFAALTPEIGAVLANTLSNLISAVLLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does recombinant expression of YciC differ from expression of cytoplasmic proteins?

Recombinant expression of membrane proteins like YciC presents distinct challenges compared to cytoplasmic proteins due to several fundamental differences:

  • Membrane insertion requirements: YciC must be properly inserted into the bacterial membrane through the Sec translocon system to achieve correct folding, unlike cytoplasmic proteins that fold in the cytosol .

  • Toxicity issues: Overexpression of membrane proteins often causes significant toxicity to the host cell by overwhelming the membrane protein insertion machinery, leading to growth inhibition and lower yields .

  • Expression kinetics: Optimal expression of membrane proteins like YciC requires careful balancing of transcription and translation rates to prevent saturation of the Sec translocon .

  • Detection methods: While cytoplasmic proteins can be directly monitored, membrane proteins are often fused with reporter proteins like GFP to monitor proper membrane integration, as properly inserted membrane proteins allow the GFP moiety to fold correctly and fluoresce .

To overcome these challenges, researchers have developed specialized expression strains like C41(DE3) and C43(DE3) (the "Walker strains") that contain mutations in the lacUV5 promoter governing T7 RNA polymerase expression, which reduce the toxicity associated with membrane protein overexpression .

What expression systems are recommended for producing recombinant YciC protein?

For recombinant production of YciC membrane protein, the following expression systems are recommended based on research findings:

Expression SystemKey FeaturesAdvantagesBest Applications
BL21(DE3)pLysSContains T7 lysozyme to reduce basal expressionGood for initial screeningSmall-scale expression trials
C41(DE3)Mutated lacUV5 promoterReduced toxicity, higher biomassMedium to high-level expression
C43(DE3)Derived from C41(DE3) with additional mutationsSlightly delayed expression, better for very toxic proteinsExpression of highly toxic membrane proteins
Lemo21(DE3)Tunable T7 RNA polymerase activityCustomizable expression levels via rhamnose titrationOptimization with a single strain

Research shows that the C41(DE3) and C43(DE3) strains are particularly effective for membrane protein expression, with yields 4-6 fold higher than BL21(DE3)pLysS after 6 hours of induction . The Lemo21(DE3) strain allows fine-tuning of expression by modulating T7 RNA polymerase activity through its natural inhibitor T7 lysozyme, making it ideal for optimization experiments with difficult membrane proteins .

For YciC specifically, expression in E. coli with an N-terminal His-tag has been documented to be successful, allowing for purification via affinity chromatography .

What purification strategies work best for recombinant YciC protein?

Effective purification of recombinant YciC requires specialized approaches due to its membrane-integrated nature:

  • Membrane extraction: The first critical step involves cell disruption followed by membrane fraction isolation through differential centrifugation. The membrane fraction containing YciC must be solubilized using appropriate detergents.

  • Detergent selection: For initial extraction, mild detergents such as n-dodecyl-β-D-maltopyranoside (DDM) or n-octyl-β-D-glucopyranoside (OG) are recommended as they effectively solubilize membrane proteins while preserving native structure.

  • Affinity purification: His-tagged YciC can be purified using immobilized metal affinity chromatography (IMAC) . The protocol should include:

    • Equilibration of Ni-NTA resin with buffer containing detergent

    • Binding of solubilized protein

    • Washing with increasing imidazole concentrations (20-40 mM)

    • Elution with higher imidazole concentration (250-300 mM)

  • Alternative to detergent: The peptidisc method offers a promising detergent-free approach for membrane protein purification. This "one-size fits all" membrane mimetic has been shown to preserve native interactions of membrane proteins that are often lost during detergent-based purification .

  • Buffer optimization: For storage, Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been demonstrated to maintain protein stability . Addition of 5-50% glycerol is recommended for long-term storage at -20°C/-80°C .

For highest purity (>90%), a combination of affinity chromatography followed by size exclusion chromatography is recommended to remove aggregates and contaminants .

How can I verify proper membrane integration of recombinant YciC?

Verification of proper membrane integration of YciC can be accomplished through several complementary techniques:

  • GFP fusion approach: Creating a C-terminal GFP fusion with YciC provides a convenient way to monitor membrane integration. When properly integrated into the membrane, the GFP moiety folds correctly and becomes fluorescent; if the fusion protein forms inclusion bodies, GFP remains unfolded and non-fluorescent . This can be measured using:

    • Fluorescence microscopy to visualize cellular localization

    • Flow cytometry to quantify expression levels per cell

    • In-gel fluorescence of membrane fractions under non-denaturing conditions

  • Subcellular fractionation: Separation of cellular compartments followed by Western blot analysis using anti-His antibodies (for His-tagged YciC) can confirm the protein's presence in the membrane fraction versus cytoplasmic or inclusion body fractions.

  • Protease accessibility assay: This technique exploits the topological arrangement of membrane proteins where certain domains are exposed to either the periplasmic or cytoplasmic face of the membrane. Limited proteolysis of spheroplasts or inverted membrane vesicles followed by mass spectrometry analysis can verify the expected topology of YciC.

  • Protein correlation profiling (PCP): When combined with quantitative proteomics techniques like SILAC (Stable Isotope Labeling with Amino acids in Cell culture), PCP can verify YciC's association with other membrane proteins, confirming its proper integration into the membrane interactome .

Research indicates that successful membrane integration is often the limiting factor for high-yield production, with yields per cell bounded by membrane space constraints rather than expression levels .

What induction conditions maximize YciC expression while minimizing toxicity?

Optimizing induction conditions is critical for balancing YciC expression with cell viability:

ParameterRecommended ConditionRationale
IPTG concentration0.1-0.4 mM (strain-dependent)Lower concentrations for BL21(DE3), higher for C41/C43 strains
Induction temperature18-20°CSlows protein production rate, allowing proper membrane insertion
Induction timingMid-log phase (OD₆₀₀ 0.6-0.8)Cells are metabolically active but not stressed
Induction duration12-16 hours at reduced temperatureExtended time compensates for slower expression rate
Media compositionTerrific Broth or 2×YT with 0.5% glucoseRich media supports membrane production; glucose reduces basal expression

For using the Lemo21(DE3) strain, L-rhamnose titration (0-2000 μM) allows precise control of T7 RNA polymerase activity and can be optimized for each specific membrane protein . Research demonstrates that the key to improved membrane protein expression is not increasing the amount per cell, but rather increasing the total biomass that can produce the protein .

Flow cytometry data shows that in optimized conditions, morphology and cell division of Walker strains (C41/C43) are less affected by membrane protein overexpression compared to BL21(DE3)pLysS, indicating reduced toxicity while maintaining similar expression levels per cell .

How does the YciC membrane protein interact with the Sec translocon during biogenesis?

The interaction between YciC and the Sec translocon represents a complex process that follows specific mechanistic pathways:

  • Co-translational targeting: As a multi-spanning membrane protein, YciC is likely recognized by the signal recognition particle (SRP) as it emerges from the ribosome. The hydrophobic transmembrane segments of YciC serve as recognition signals for SRP binding.

  • SecYEG engagement: Upon delivery to the membrane, YciC engages with the SecYEG translocon complex, which forms a protein-conducting channel that facilitates the insertion of transmembrane segments into the lipid bilayer. Research using peptidisc-based interactome analysis has revealed that the SecYEG complex interacts with several membrane-bound chaperones including YfgM and PpiD that may assist in the folding of complex membrane proteins like YciC .

  • YidC assistance: The membrane insertase YidC, which interacts with the SecYEG complex as part of the "holo-translocon," likely plays a critical role in the lateral release of YciC's transmembrane segments into the lipid bilayer. Proteomic studies have identified YidC as an enriched interactor in SecY pulldown experiments using the peptidisc method .

  • Potential trans-periplasmic associations: Interestingly, interactome studies have identified a potential super-complex comprising both the Sec machinery (inner membrane) and the Bam complex (outer membrane) . This raises the intriguing possibility that some membrane proteins might be processed in a coordinated manner across both membranes of the cell envelope.

When overexpressing YciC, saturation of the Sec translocon is a primary cause of toxicity. The mutations in the Walker strains work by reducing transcription rates to match the capacity of the Sec machinery, thereby "harmonizing translation and insertion into the membrane" .

What is known about the biological function of YciC in E. coli O7:K1?

The biological function of YciC in E. coli O7:K1 remains largely uncharacterized, though several lines of evidence provide insights:

  • Structural features: The protein contains multiple predicted transmembrane domains typical of transporters or channels. Sequence analysis reveals conserved motifs associated with small molecule transport, suggesting a potential role in membrane permeability or solute trafficking.

  • Genomic context: In E. coli O7:K1, which is known to cause invasive infections including neonatal meningitis , the YciC protein may contribute to virulence or environmental adaptation. The O7 serotype is defined by its specific O-antigen lipopolysaccharide, the biosynthesis of which involves multiple membrane-associated proteins .

  • Expression patterns: The yciC gene shows differential expression under stress conditions, particularly in response to changes in osmolarity and during biofilm formation, suggesting a potential role in adaptation to environmental conditions.

  • Pathogenicity associations: E. coli K1 strains are particularly virulent in causing meningitis, with the O1:K1:H7 serotype showing "special virulence" reflected by "acuteness of onset of infection" . While direct evidence for YciC's role in pathogenicity is lacking, its conservation in pathogenic strains suggests potential importance.

  • Interactome data: Protein correlation profiling studies suggest YciC may associate with other membrane proteins involved in envelope integrity or transport functions .

The classification of YciC in the UPF0259 family (Uncharacterized Protein Family) indicates that while it is conserved across multiple bacterial species, its precise function remains to be elucidated through targeted experimental approaches.

How do post-translational modifications affect YciC structure and function?

Post-translational modifications (PTMs) of YciC remain an understudied area, but available evidence and comparative analysis with similar membrane proteins suggests several possible modifications:

  • Disulfide bond formation: Analysis of the YciC sequence reveals the presence of cysteine residues that could potentially form disulfide bonds in the oxidizing environment of the periplasm. These bonds could stabilize extracellular loops and affect protein conformation.

  • Lipid interactions: As an integral membrane protein, YciC likely interacts specifically with phospholipids in the E. coli membrane. These interactions may be essential for proper folding and function. Research on other membrane proteins shows that specific lipid-protein interactions can significantly impact protein stability and activity.

  • Oligomerization states: Many membrane proteins function as oligomers, and YciC may form homo-oligomeric structures. This assembly process could be regulated by modifications at specific interface residues.

  • Proteolytic processing: Some membrane proteins undergo regulated proteolysis as part of their functional cycle or regulation. Analysis of purified recombinant YciC using mass spectrometry could reveal whether any regions are cleaved during maturation.

  • Specific E. coli K1 considerations: The K1 capsular antigen of E. coli O7:K1 is a polysialic acid structure that creates a protective layer around the bacterium. The expression and function of membrane proteins like YciC may be influenced by this unique capsular environment and could potentially interact with capsule biosynthesis machinery.

To properly investigate these potential modifications, researchers should consider using multiple complementary techniques including mass spectrometry-based proteomics, cross-linking studies, and native gel electrophoresis on protein isolated under non-denaturing conditions .

How can I design experiments to investigate YciC protein-protein interactions?

Designing experiments to investigate YciC protein-protein interactions requires multiple complementary approaches:

  • Peptidisc-based interactome analysis: This emerging technique has shown significant advantages for membrane protein interaction studies. The protocol involves:

    • Capturing the E. coli membrane proteome in peptidisc scaffolds

    • High-resolution fractionation without detergents

    • SILAC labeling followed by protein correlation profiling (PCP)

    • Mass spectrometry analysis to identify co-eluting proteins

    This approach has successfully identified novel interactions in well-characterized membrane protein systems that were largely undetected by standard detergent-based purification .

  • In vivo crosslinking: Chemical crosslinkers that can penetrate the membrane, such as DSS or formaldehyde, can capture transient interactions. For membrane-specific crosslinking, photoactivatable lipid analogs can be incorporated into membranes and used to identify lipid-protein and protein-protein interfaces.

  • Bacterial two-hybrid systems: Modified for membrane proteins, these systems can detect binary interactions. The BACTH system (Bacterial Adenylate Cyclase Two-Hybrid) is particularly suitable for membrane protein studies as it allows fragments of adenylate cyclase to be fused to the termini of membrane proteins located in the cytoplasm.

  • Co-immunoprecipitation with quantitative readout: Using the SILAC AP/MS workflow with YciC as bait:

    • Express His-tagged YciC in SILAC-labeled cells

    • Perform affinity pulldown with anti-His antibodies

    • Compare protein enrichment ratios between sample and control

    • Set statistical thresholds to identify significant interactions

    Research shows this approach can identify both established and novel protein interactions with high confidence .

  • Validation experiments: Any identified interactions should be validated using reciprocal pulldowns, where the putative interacting partner is used as bait to confirm binding to YciC.

The peptidisc method has proven particularly valuable for membrane protein interaction studies, as demonstrated by the discovery of a trans-periplasmic supercomplex comprising subunits of the Bam and Sec machineries that was not detected using standard detergent approaches .

What strategies can resolve difficulties in crystallizing YciC for structural studies?

Crystallizing membrane proteins like YciC presents significant challenges. Here are strategic approaches to overcome these difficulties:

  • Construct optimization:

    • Create a library of N- and C-terminal truncations to remove disordered regions

    • Design fusion proteins with crystallization chaperones (e.g., T4 lysozyme, BRIL)

    • Identify and mutate surface residues with high entropy to alanine

    • Screen multiple orthologs of YciC from different bacterial species

  • Detergent screening and optimization:

    • Perform thermal stability assays across a panel of detergents

    • Test mixed detergent systems and amphipols

    • Consider detergent exchange during purification steps

    • Use lipidic cubic phase (LCP) for in meso crystallization

  • Alternative membrane mimetics:

    • Nanodiscs with defined lipid composition

    • Amphipols for detergent-free stabilization

    • Peptidiscs, which have shown promise for maintaining native membrane protein interactions

    • Styrene maleic acid lipid particles (SMALPs) to extract membrane proteins with their native lipid environment

  • Crystal optimization techniques:

    • Utilize lipid additives that stabilize crystal contacts

    • Screen with heavy atom compounds for experimental phasing

    • Implement controlled dehydration of crystal samples

    • Employ microseeding and cross-seeding techniques

  • Alternative structural methods:

    • Consider single-particle cryo-electron microscopy (cryo-EM), which has revolutionized membrane protein structural biology

    • Solid-state NMR for specific structural elements

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for conformational dynamics

  • Antibody fragment co-crystallization:

    • Generate specific antibody fragments (Fab or nanobodies) against YciC

    • Use these fragments as crystallization chaperones to create additional crystal contacts

The choice of E. coli expression system impacts the quality of protein for crystallization. The Lemo21(DE3) strain offers tunable expression that can be optimized for producing properly folded YciC, potentially improving crystallization success rates .

How can I design a CRISPR-Cas9 system to study YciC function through gene knockout and complementation?

Designing a CRISPR-Cas9 system to study YciC function requires careful consideration of E. coli genetic manipulation techniques:

  • Target selection and gRNA design:

    • Identify unique regions within the yciC gene using genome browser tools

    • Design multiple gRNAs targeting different regions of the gene to increase knockout efficiency

    • Validate gRNA specificity using tools like Cas-OFFinder to minimize off-target effects

    • Design gRNAs with NGG PAM sites and optimal GC content (40-60%)

  • Vector system components:

    • Select an appropriate Cas9 variant (e.g., SpCas9 for standard targeting)

    • Choose inducible promoters for Cas9 and gRNA expression

    • Include selectable markers compatible with E. coli O7:K1

    • Incorporate homology-directed repair (HDR) templates to facilitate precise gene knockout

  • Knockout strategy:

    • Design HDR templates with antibiotic resistance cassettes flanked by homology arms (~500 bp)

    • Include unique restriction sites or barcode sequences for PCR verification

    • Consider creating scarless deletions using two-step selection/counterselection systems

  • Complementation system design:

    • Create expression vectors with native promoter-driven yciC

    • Design vectors with inducible promoters for controlled expression

    • Include variants with epitope tags for protein detection

    • Create site-directed mutants to test specific protein domains

  • Validation approaches:

    • PCR verification of genomic modifications

    • Western blot analysis to confirm protein absence/presence

    • RNA-seq to evaluate potential polar effects on neighboring genes

    • Whole-genome sequencing to confirm single integration and absence of off-target effects

  • Phenotypic analysis:

    • Growth curve analysis under various conditions

    • Membrane integrity assays

    • Transport function tests if applicable

    • Virulence assessment in appropriate models if working with pathogenic E. coli O7:K1 strains

For E. coli O7:K1, which can cause meningitis and neonatal infections , knockout studies should include assessment of virulence-associated phenotypes such as serum resistance, invasion of brain microvascular endothelial cells, and capsule expression. Complementation studies can determine whether YciC plays a direct role in these processes.

How should I analyze mass spectrometry data to identify post-translational modifications in YciC?

Analyzing mass spectrometry data for post-translational modifications (PTMs) in YciC requires a systematic approach:

  • Sample preparation optimization:

    • Employ multiple proteases (trypsin, chymotrypsin, elastase) to improve sequence coverage

    • Use enrichment strategies for specific PTMs (e.g., phosphopeptide enrichment)

    • Preserve labile modifications by adjusting buffer conditions and processing times

    • Prepare detergent-free samples using peptidisc technology for membrane proteins

  • Data acquisition strategies:

    • Implement data-dependent acquisition (DDA) with inclusion lists for predicted modified peptides

    • Use data-independent acquisition (DIA) for comprehensive detection

    • Apply parallel reaction monitoring (PRM) for targeted analysis of suspected modifications

    • Utilize electron-transfer dissociation (ETD) or electron-capture dissociation (ECD) for PTMs that are labile under collision-induced dissociation (CID)

  • Database search parameters:

    • Include variable modifications relevant to bacterial proteins (methylation, acetylation, etc.)

    • Set appropriate mass tolerances based on instrument capabilities

    • Allow for multiple missed cleavages, especially around modification sites

    • Consider semi-tryptic peptides to account for proteolytic processing

  • Validation criteria:

    • Require fragment ions that directly localize the modification site

    • Apply strict false discovery rate controls (1% at peptide level)

    • Validate biological replicates for reproducibility

    • Implement retention time prediction as additional validation

  • Quantitative analysis:

    • Compare modification stoichiometry across different conditions

    • Use label-free quantification or SILAC approaches

    • Apply normalization to account for differences in protein abundance

    • Calculate site occupancy where possible

  • Specialized software tools:

    • MaxQuant with dependent peptide search for unbiased PTM detection

    • Byonic for complex glycopeptide analysis

    • MSFragger for open search approaches

    • PTM-Shepherd for PTM discovery and validation

For transmembrane proteins like YciC, special consideration should be given to membrane-proximal modifications that may regulate topology or protein-protein interactions. The peptidisc method has been shown to preserve native membrane protein states and may reveal modifications that are lost during detergent extraction .

What statistical approaches are appropriate for analyzing YciC protein-protein interaction networks?

Statistical analysis of YciC protein-protein interaction networks requires robust approaches to distinguish genuine interactions from random associations:

  • Scoring systems for primary interaction data:

    • SAINT (Significance Analysis of INTeractome) algorithm for probabilistic scoring of protein interactions

    • CompPASS (Comparative Proteomics Analysis Software Suite) for identifying high-confidence interacting proteins

    • MiST (Mass spectrometry interaction STatistics) scoring incorporating abundance, reproducibility, and specificity

  • False discovery rate control:

    • Implement target-decoy approaches at the interaction level

    • Apply permutation-based methods to establish null distributions

    • Set appropriate cutoffs based on experimental goals (stricter for high-confidence networks)

  • Network construction and analysis:

    • Calculate interaction probabilities using empirical Bayes methods

    • Apply Markov clustering for identifying protein complexes

    • Implement randomization tests to assess network significance

  • Reference dataset integration:

    • Compare detected interactions with previously validated datasets

    • Calculate enrichment statistics for known complexes

    • Implement supervised machine learning using gold-standard interactions for training

  • Visualization and interpretation:

    • Generate network diagrams weighted by confidence scores

    • Apply force-directed layouts based on interaction strengths

    • Implement clustering algorithms to identify functional modules

In a practical example from the search results, researchers analyzing the E. coli membrane interactome using protein-correlation-profiling (PCP) with SILAC labeling generated over 4,900 possible binary interactions from >700,000 random associations . The significance of this interactome was validated by comparing it with independently collected interactomes, demonstrating that the number of interactions in the subset was significantly greater than expected by chance (p<0.001) .

For YciC specifically, setting appropriate thresholds for interaction confidence is critical. Researchers recommend creating a "High Confidence" dataset by integrating multiple independent studies and focusing on interactions that appear consistently across experiments .

How can I interpret contradictory results between in vitro and in vivo studies of YciC function?

Resolving contradictions between in vitro and in vivo YciC functional studies requires systematic analysis:

  • Technical considerations for reconciliation:

    • Expression levels: In vitro overexpression often exceeds physiological concentrations. Quantify absolute protein levels in both settings using techniques like selected reaction monitoring (SRM) mass spectrometry.

    • Membrane environment: In vitro systems use detergents or artificial membranes that may not recapitulate the native lipid environment. Consider using native membrane mimetics like peptidiscs which preserve protein-protein interactions often lost during detergent extraction .

    • Post-translational modifications: Check whether the in vitro protein lacks modifications present in vivo using mass spectrometry approaches.

    • Protein partners: Many membrane proteins function in complexes; the absence of interacting partners in vitro may alter function.

  • Experimental design for resolution:

    • Gradient approaches: Create intermediate conditions between in vitro and in vivo settings (e.g., spheroplasts, inside-out membrane vesicles, proteoliposomes with native lipids).

    • Domain-specific analysis: Test individual domains separately to identify which regions are responsible for discrepancies.

    • Chimeric proteins: Swap domains between functional and non-functional constructs to pinpoint critical regions.

    • Point mutations: Create site-directed mutants targeting residues involved in suspected functions.

  • Analytical framework:

    • Function vs. activity matrix: Create a comprehensive comparison table documenting which functions are observed in which experimental settings.

    • Condition-dependent behavior: Systematically test whether specific environmental conditions (pH, ionic strength, temperature) resolve contradictions.

    • Time-dependent analysis: Determine if contradictions reflect differences in measurement timescales rather than actual functional differences.

  • Case studies from membrane protein research:

    • Research on membrane proteins like SecY has shown that interaction partners such as YfgM and PpiD are hardly detected in detergent unless all subunits are simultaneously overproduced in the membrane, suggesting that proper subunit stoichiometry is critical for complex formation .

    • The well-characterized SecYEG complex demonstrates different interactomes when studied in detergent versus peptidisc conditions, with interactions with the Bam complex specifically being undetectable in detergent .

When working with membrane proteins like YciC, contradictions often stem from the artificial environment created during in vitro studies. The recent development of the peptidisc method represents a promising approach to bridge this gap by allowing the study of membrane proteins in a more native-like environment without detergents .

How might YciC be involved in pathogenicity of E. coli O7:K1 strains?

The potential role of YciC in E. coli O7:K1 pathogenicity can be explored through multiple angles:

  • Association with virulence determinants:

    • E. coli K1 strains are known to cause neonatal meningitis, with the K1 capsular polysaccharide being a major virulence factor .

    • The O7 serotype is defined by its lipopolysaccharide (LPS) O-antigen, which contributes to serum resistance and immune evasion. The O7-LPS biosynthesis region encompasses approximately 14 kilobase pairs and encodes at least 16 polypeptides .

    • As a membrane protein, YciC could potentially participate in capsule assembly, LPS biosynthesis, or membrane remodeling during host interaction.

  • Potential mechanisms of virulence contribution:

    • Membrane integrity: YciC may help maintain membrane stability under the stress conditions encountered during infection.

    • Transport functions: Based on structural predictions, YciC might function in the transport of nutrients or export of virulence factors.

    • Signaling: Membrane proteins often participate in sensing and signaling activities that coordinate virulence gene expression.

    • Host interaction: YciC could potentially facilitate direct interaction with host cells, similar to outer membrane protein A (OmpA), which contributes significantly to E. coli K1 pathogenesis .

  • Comparative analysis with other pathogenic strains:

    • E. coli O1:K1:H7 demonstrates "special virulence" in acute pyelonephritis, characterized by a shorter duration of symptoms before diagnosis, higher fever, and higher peripheral leukocyte counts compared to other strains .

    • Similar membrane proteins in other pathogenic bacteria have been implicated in adhesion, invasion, and immune evasion.

  • Research approaches to investigate YciC's role in pathogenesis:

    • Gene knockout studies in animal infection models

    • Transcriptomic analysis to determine if yciC expression changes during infection

    • Interaction studies with host proteins

    • Comparison of YciC sequence and expression between pathogenic and non-pathogenic strains

While direct evidence specifically linking YciC to pathogenicity is currently limited, its conservation in invasive E. coli strains suggests it may play a role in the bacterium's adaptation to host environments or in specific virulence mechanisms.

What are the challenges in using recombinant YciC as a potential vaccine antigen?

Developing recombinant YciC as a vaccine antigen presents several challenges that must be addressed:

  • Structural and expression challenges:

    • Membrane protein purification: As a multi-spanning membrane protein, YciC is difficult to express and purify in its native conformation. Unlike the successful example of OmpA, which was engineered as a vaccine candidate by connecting its extracellular loops , YciC's topology may make this approach more challenging.

    • Conformational epitopes: Effective antibody responses often target conformational epitopes that may be lost during purification or antigen preparation.

    • Expression systems: Special expression systems like the Walker strains or Lemo21(DE3) would be needed for high-yield production .

  • Immunological considerations:

    • Antigenicity assessment: Unlike established vaccine candidates such as OmpA, the immunogenicity of YciC and its ability to induce protective immunity remains uncharacterized.

    • Cross-reactivity: Potential homology with human proteins could lead to autoimmune responses.

    • Adjuvant requirements: Membrane proteins often require specific adjuvant formulations to enhance immunogenicity while maintaining structure.

  • Practical vaccine development issues:

    • Stability concerns: Membrane proteins are typically less stable than soluble proteins, creating challenges for vaccine formulation and storage.

    • Scalability: Production would require optimization of large-scale membrane protein expression and purification protocols.

    • Reproducibility: Ensuring consistent conformational presentation between batches is difficult for membrane proteins.

  • Design strategies to overcome challenges:

    • Epitope identification: Using computational prediction and experimental mapping to identify highly antigenic and accessible regions of YciC.

    • Synthetic approach: Following the successful example of OmpAVac, an artificial protein could be designed using only the extracellular portions of YciC connected as a soluble construct .

    • Peptide vaccines: Focusing on specific immunogenic peptides rather than the whole protein.

    • Expression optimization: Utilizing Lemo21(DE3) with rhamnose titration to fine-tune expression levels for optimal folding .

  • Alternative approaches:

    • Outer membrane vesicle (OMV) vaccines: Incorporating YciC into OMVs to maintain native conformation.

    • DNA or mRNA vaccines: Encoding YciC for in vivo expression.

    • Multi-antigen approach: Combining YciC with other E. coli antigens for broader protection.

Experience with the OmpA vaccine candidate for E. coli K1 shows that rational design based on protein structure can overcome production difficulties. The OmpAVac construct, composed of connected loops from OmpA, induced Th1, Th2, and Th17 immune responses and conferred effective protection in mice .

What novel applications might emerge from understanding the structure-function relationship of YciC?

Understanding the structure-function relationship of YciC could enable several innovative applications:

  • Therapeutic target development:

    • If YciC plays a crucial role in E. coli O7:K1 virulence, it could serve as a target for novel antimicrobials that specifically inhibit pathogenic strains.

    • Structure-based drug design could yield small molecules that bind to critical functional sites.

    • Peptide inhibitors designed to disrupt specific protein-protein interactions involving YciC could represent a new class of antimicrobials.

  • Biotechnology applications:

    • Membrane protein expression platform: Insights from YciC expression studies could lead to improved systems for producing other difficult membrane proteins.

    • Biosensor development: If YciC functions as a transporter or channel, its specificity could be harnessed to create biosensors for relevant molecules.

    • Membrane protein engineering: Understanding YciC's folding and stability could enable the engineering of stable membrane protein scaffolds for biotechnology applications.

  • Synthetic biology opportunities:

    • Engineered cellular compartments: YciC or derivatives could potentially be used to create specialized membrane domains with controlled permeability.

    • Minimal cell design: Knowledge of essential membrane proteins like YciC contributes to our understanding of the minimal components needed for cellular function.

    • Novel membrane protein scaffolds: The YciC structure could serve as a starting point for designing membrane proteins with new functions.

  • Evolutionary insights and applications:

    • Comparative analysis of YciC across bacterial species could reveal adaptation mechanisms for different environmental niches.

    • Understanding how membrane protein diversity contributes to bacterial adaptation may enable the prediction of emerging pathogen characteristics.

    • Phylogenetic analysis of YciC variants could provide insights into bacterial evolution and host adaptation.

  • Methodological advances:

    • Optimizing YciC expression and purification could lead to improved protocols for handling other membrane proteins.

    • The peptidisc method, which has proven valuable for studying membrane protein interactions , could be further refined through work with YciC.

    • Novel crystallization strategies developed for YciC might be applicable to other recalcitrant membrane proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.