Recombinant Escherichia coli O7:K1 UPF0266 membrane protein yobD (yobD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yobD; ECIAI39_1232; UPF0266 membrane protein YobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-152
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
yobD
Target Protein Sequence
MTITDLVLILFIAALLAFAIYDQFIMPRRNGPTLLAIPLLRRGRIDSVIFVGLIVILIYN NVTNHGALITTWLLSALALMGFYIFWIRVPKIIFKQKGFFFANVWIEYSRIKAMNLSEDG VLVMQLEQRRLLIRVRNIDDLEKIYKLLVSTQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0266 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0266 membrane protein yobD in E. coli O7:K1 strains?

UPF0266 membrane protein yobD belongs to a family of membrane-associated proteins found in various E. coli strains. Based on sequence analysis from related strains, it is a relatively small membrane protein consisting of approximately 152 amino acids with multiple predicted transmembrane domains . The protein sequence typically contains hydrophobic regions consistent with membrane insertion, suggesting its localization in the bacterial membrane. In E. coli O7:K1 strains, which are associated with neonatal meningitis, this protein may contribute to bacterial pathogenesis, though its precise function remains under investigation.

What is the relationship between yobD and other membrane components in E. coli O7:K1?

While direct evidence linking yobD to other specific membrane components in E. coli O7:K1 is limited, there are important associations to consider. E. coli O7:K1 strains possess distinctive lipopolysaccharide (LPS) structures, with studies identifying a region of approximately 17 kilobase pairs essential for O7 LPS expression . The O7 polysaccharide biosynthesis region has been characterized through genetic analysis, with at least 16 polypeptides encoded within this region with molecular masses ranging from 20 to 48 kilodaltons . Given that yobD is a membrane protein, it may functionally interact with these membrane components, though this relationship requires further investigation.

How is yobD genetically organized in E. coli strains?

The yobD gene in E. coli strains is chromosomally encoded. In some E. coli strains, it has been identified as gene c2227 . The genomic context of yobD may provide insights into its function, as bacterial genes with related functions are often organized in operons or functional clusters. Transcriptional analysis of similar membrane-associated regions in E. coli O7:K1 has demonstrated that transcription can occur in a single direction along these genetic regions , suggesting coordinated expression of functionally related proteins.

What approaches are recommended for cloning and expressing recombinant yobD from E. coli O7:K1?

Based on established protocols for similar membrane proteins, researchers should consider the following methodological approach:

  • Gene amplification: Design specific primers based on the yobD sequence to amplify the gene from genomic DNA of E. coli O7:K1.

  • Vector selection: Choose appropriate expression vectors that are optimized for membrane protein expression, potentially including a fusion tag to facilitate purification.

  • Host selection: While standard E. coli K-12 strains can express recombinant proteins from E. coli O7:K1 , specialized strains designed for membrane protein expression may yield better results.

  • Expression conditions: Optimize induction parameters including temperature, inducer concentration, and duration to maximize protein yield while maintaining proper folding.

Studies on recombinant expression of proteins from E. coli O7:K1 have demonstrated that while expression in E. coli K-12 is possible, the yield may be lower compared to the native strain . Therefore, careful optimization of expression conditions is critical for obtaining functional protein.

What methods are effective for verifying the expression and localization of recombinant yobD?

To verify successful expression and proper localization of recombinant yobD, researchers should employ multiple complementary techniques:

  • Western blotting: Using antibodies against either yobD or fusion tags to confirm expression at the expected molecular weight.

  • Membrane fractionation: Separate cellular components to verify localization in the membrane fraction, similar to methods used for analyzing O7 LPS expression involving extraction of total membranes with hot phenol .

  • Immunofluorescence microscopy: For in situ visualization of the protein's localization within bacterial cells.

  • Proteomic analysis: Mass spectrometry-based identification of the expressed protein to confirm its identity.

For membrane proteins from E. coli O7:K1, verification of proper membrane insertion is particularly important, as improper localization could affect both function and immunological properties.

How can researchers design mutation studies to investigate yobD function?

To systematically investigate yobD function through mutation studies, researchers can employ approaches similar to those used for other E. coli O7:K1 membrane components:

  • Transposon mutagenesis: This approach has proven effective for identifying functional regions in O7-LPS biosynthesis genes . Using transposons carrying reporter genes like lacZ can simultaneously disrupt gene function and generate transcriptional fusions to monitor expression patterns.

  • Site-directed mutagenesis: Target conserved residues or predicted functional domains within yobD to create specific mutations.

  • Deletion mutagenesis: Create complete gene knockouts using homologous recombination techniques, similar to methods employed for studying the ETT2 region in E. coli O7:K1 .

  • Complementation studies: Reintroduce wild-type or mutated versions of yobD into knockout strains to confirm phenotype restoration, a method that has proven valuable in O7-LPS studies .

Each mutant should be characterized for membrane integrity, protein expression levels, and relevant virulence phenotypes.

How might yobD contribute to the pathogenesis of E. coli O7:K1 infections?

While the specific role of yobD in E. coli O7:K1 pathogenesis remains to be elucidated, several research approaches can address this question:

  • Invasion and survival assays: The contribution of yobD to bacterial interaction with human brain microvascular endothelial cells (HBMEC) should be investigated, similar to studies conducted with ETT2 mutants that demonstrated defects in invasion and intracellular survival .

  • Comparative virulence studies: Compare the virulence of wild-type and yobD mutant strains in appropriate animal models of E. coli O7:K1 infection, particularly those modeling meningitis.

  • Host response analysis: Examine how yobD affects host immune recognition and response, potentially through alterations in bacterial surface properties.

Studies on type III secretion systems in E. coli O7:K1 strain EC10 have demonstrated their importance in invasion and intracellular survival in HBMEC , suggesting a potential model for investigating membrane protein contributions to virulence.

What is the relationship between yobD and the type III secretion system in E. coli O7:K1?

E. coli O7:K1 strains possess a putative type III secretion system (ETT2) that plays a role in bacterial pathogenesis . To investigate potential relationships between yobD and ETT2:

  • Co-expression analysis: Examine whether yobD expression correlates with ETT2 component expression under various conditions.

  • Protein interaction studies: Investigate potential direct or indirect interactions between yobD and ETT2 components.

  • Mutant phenotype comparison: Compare the phenotypes of yobD and ETT2 mutants (such as eivA mutants) in invasion and intracellular survival assays .

  • Complementation studies: Determine if overexpression of yobD can compensate for defects in ETT2 function, or vice versa.

Research on ETT2 in E. coli O7:K1 strain EC10 has shown that mutations in this system result in defects in invasion and intracellular survival in HBMEC, which can be restored by complementation . Similar approaches could reveal functional relationships with yobD.

What techniques are most effective for studying protein-protein interactions involving yobD?

Investigating protein-protein interactions for membrane proteins like yobD requires specialized approaches:

  • Bacterial two-hybrid systems: Modified versions designed specifically for membrane proteins can detect interactions in a cellular context.

  • Co-immunoprecipitation: Using detergent conditions that maintain membrane protein complexes intact.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry identification can capture transient interactions in native membrane environments.

  • FRET-based approaches: For detecting interactions in living bacteria when using fluorescent protein fusions.

  • Split-reporter systems: Such as split-GFP, which can be particularly useful for membrane protein interaction studies.

These techniques have been adapted for studying interactions between membrane components and should be optimized for the specific characteristics of yobD and its potential partners.

What factors should be considered when designing experiments involving recombinant yobD?

Successful experiments with recombinant yobD require careful consideration of multiple factors:

FactorConsiderationsRecommendations
Expression systemHost strain compatibilityC41/C43 strains for toxic membrane proteins
Growth conditionsTemperature, media, aerationLower temperatures (16-30°C) often improve folding
Induction parametersInducer concentration, timingGradual induction may prevent aggregation
Purification methodDetergent selection, buffer compositionMild detergents preserve native structure
Storage conditionsTemperature, buffer componentsInclude glycerol (50%) for stability at -20°C
Experimental controlsPositive and negative controlsInclude wild-type comparisons

Additionally, researchers should consider the experimental design principles outlined for complex experimental systems, including proper randomization, replication, and statistical analysis approaches .

How can researchers address data variability in experiments with recombinant membrane proteins?

When working with recombinant membrane proteins like yobD, several sources of variability must be addressed:

  • Batch-to-batch variation: Studies have demonstrated significant differences between experimental stages when using different batches of materials . Researchers should implement quality control measures and use consistent source materials when possible.

  • Expression level variability: Monitor protein expression levels across experiments using quantitative Western blotting or other suitable methods.

  • Functional heterogeneity: Assess protein functionality using multiple complementary assays rather than relying on a single readout.

  • Statistical approach: Apply appropriate statistical methods for analyzing variability, including ANOVA for multi-factor experiments and appropriate post-hoc tests .

  • Experimental design: Consider factorial or central composite designs that can efficiently explore multiple variables simultaneously while detecting interaction effects .

By systematically addressing these sources of variability, researchers can increase the reliability and reproducibility of experiments involving recombinant yobD.

What approaches are recommended for optimizing yobD expression and purification?

The expression and purification of membrane proteins like yobD require systematic optimization:

StageApproachVariables to Optimize
ExpressionFactorial design testingHost strain, temperature, media composition, inducer concentration
Cell lysisMethod comparisonChemical, enzymatic, or mechanical disruption methods
Membrane extractionDetergent screeningType and concentration of detergents for efficient extraction
PurificationChromatography optimizationBuffer composition, salt concentration, pH, flow rate
Functional validationActivity assaysDevelopment of specific assays relevant to predicted function

The purification protocol should be tailored to the specific properties of yobD, with careful consideration of conditions that maintain protein stability and function. For recombinant proteins, storage in appropriate buffers with stabilizing agents like glycerol is recommended, with storage at -20°C or -80°C for extended periods .

What emerging technologies could advance our understanding of yobD function?

Several cutting-edge technologies hold promise for elucidating yobD function:

  • Cryo-electron microscopy: For high-resolution structural analysis of yobD in its native membrane environment.

  • Single-molecule techniques: To study dynamic behaviors and interactions of individual yobD molecules.

  • CRISPR-Cas9 genome editing: For precise manipulation of yobD and related genes in E. coli O7:K1.

  • Advanced imaging: Super-resolution microscopy techniques for visualizing yobD localization and dynamics in living bacteria.

  • Systems biology approaches: Integration of multiple -omics datasets to place yobD within broader cellular networks.

These technologies could overcome limitations of traditional approaches and provide novel insights into yobD's role in bacterial physiology and pathogenesis.

How can researchers integrate genetic and biochemical approaches to study yobD?

A comprehensive understanding of yobD requires integration of multiple research approaches:

  • Genetic analysis: Building on techniques used for O7-LPS gene characterization, such as transposon mutagenesis with reporter gene fusions to identify functional domains and expression patterns .

  • Biochemical characterization: Purification and in vitro analysis of yobD to determine its molecular properties and potential interaction partners.

  • Structural biology: Determination of three-dimensional structure to inform structure-function relationships.

  • Cellular microbiology: Investigation of yobD's role in bacterial interactions with host cells, particularly brain microvascular endothelial cells relevant to meningitis pathogenesis .

  • In vivo models: Evaluation of yobD's contribution to virulence in animal models of E. coli O7:K1 infection.

By integrating these complementary approaches, researchers can develop a comprehensive understanding of yobD's biological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.