Recombinant Escherichia coli O7:K1 UPF0283 membrane protein ycjF (ycjF)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Escherichia coli O7:K1 UPF0283 membrane protein ycjF (ycjF) is a protein expressed in Escherichia coli (E. coli) that belongs to a family of proteins with unknown function (UPF0283) . The ycjF gene encodes a membrane protein, and in this case, it is derived from the O7:K1 strain of E. coli .

Characteristics of Escherichia coli O7:K1

E. coli K1 strains are known to cause meningitis in neonates . E. coli K1 can express outer membrane protein A (OmpA), which allows it to enter, survive, and replicate inside dendritic cells (DCs) . OmpA(+) E. coli K1 prevents DCs from progressing in their maturation process by failing to up-regulate costimulatory molecules .

Genomic Context

Comparative genomic hybridization has been used to investigate E. coli K1 strains isolated from cerebrospinal fluid (CSF) of patients . This involves using oligonucleotides targeting open reading frames (ORFs) present in various E. coli strains .

Function and Role

The precise function of the UPF0283 membrane protein ycjF in E. coli O7:K1 is not well-defined . Proteins of unknown function (UPF) are identified through genomic and proteomic analyses, but their specific roles in cellular processes require further experimental investigation.

Recombinant Production

Recombinant E. coli O7:K1 UPF0283 membrane protein ycjF (ycjF) can be produced using an in vitro E. coli expression system .

Outer Membrane Protein A (OmpA) Allelic Variation

Allelic variation in E. coli outer membrane protein A (OmpA) impacts cell surface properties, stress tolerance, and allele distribution . OmpA affects cell surface charge (zeta potential), cell surface hydrophobicity, biofilm formation, sensitivity to killing by neutrophil elastase, and specific growth rate at 42°C and in the presence of acetate .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycjF; ECIAI39_1674; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
ycjF
Target Protein Sequence
MTEPLKPRIDFDGPLDVDQNPEFRAQQTFDENQAQNFAPATLDEAPEEEGQVEAVMDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE TQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWLDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are suitable for producing recombinant UPF0283 membrane protein YcjF?

Multiple expression systems can be utilized for the production of recombinant UPF0283 membrane protein YcjF, each with distinct advantages:

  • Escherichia coli: Provides the highest yield and shortest turnaround time, making it ideal for initial structural and functional studies .

  • Yeast: Offers good yields while providing some post-translational modifications that might be important for proper protein folding .

  • Insect cells with baculovirus: Provides more complex post-translational modifications that could be necessary for retaining specific protein functions .

  • Mammalian cells: Offers the most sophisticated post-translational modification system, which may be crucial for maintaining activity in complex functional studies .

The choice of expression system should be guided by the specific research objectives. For initial characterization and high-throughput studies, E. coli is recommended due to its efficiency and cost-effectiveness. For studies requiring native-like protein structure and function, insect or mammalian cell expression systems may be more appropriate despite their lower yields.

How can I confirm successful expression of recombinant YcjF protein?

Confirmation of successful YcjF expression requires a multi-method approach:

  • SDS-PAGE analysis: Visualize the expressed protein band corresponding to the expected molecular weight of YcjF (approximately 38-40 kDa based on its 353 amino acid sequence).

  • Western blot analysis: Use antibodies specific to YcjF or to an engineered tag (such as His-tag or FLAG-tag) if incorporated into the recombinant construct.

  • Mass spectrometry: Provide definitive identification through peptide mass fingerprinting.

  • Functional assays: Though challenging due to incomplete understanding of YcjF's precise function, activity-based assays can be developed based on predicted membrane-associated roles.

  • Membrane fraction isolation: Since YcjF is a membrane protein, successful expression should result in the protein being predominantly found in membrane fractions rather than cytosolic fractions when performing cellular fractionation.

Combining these methods provides comprehensive confirmation of both expression and proper localization of the recombinant YcjF protein.

What strategies can be employed to optimize the expression of functional YcjF in E. coli?

Optimizing functional YcjF expression in E. coli requires addressing several critical parameters:

  • Codon optimization: Adjust the coding sequence to match the codon usage bias of the expression host. This is particularly important for membrane proteins like YcjF to ensure efficient translation.

  • Promoter selection: Test multiple promoter systems (T7, tac, araBAD) to identify optimal expression conditions. For membrane proteins, moderate expression rates often yield higher amounts of correctly folded protein.

  • Temperature modulation: Lower temperatures (16-25°C) typically favor proper folding of membrane proteins by slowing down protein synthesis and providing adequate time for membrane insertion.

  • Fusion partners: Consider fusion with solubility enhancers (MBP, SUMO, or TrxA) or specialized membrane protein fusion partners that can be later removed via engineered protease sites.

  • Membrane-targeting strategies: Utilize signal sequences that direct the recombinant protein to the correct membrane compartment.

  • Host strain selection: E. coli strains engineered for membrane protein expression (such as C41/C43(DE3) or Lemo21(DE3)) often provide superior results compared to standard BL21(DE3) strains.

  • Chaperone co-expression: Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) to assist in proper folding of complex membrane proteins.

These approaches can be methodically tested in factorial experimental designs to determine the optimal combination for YcjF expression.

How can I design effective transposon mutagenesis to study the functional domains of YcjF?

Designing effective transposon mutagenesis to study YcjF functional domains requires a systematic approach similar to that employed for O7-LPS genes :

  • Vector selection: Choose a transposon system that allows for both disruption and transcriptional fusion capabilities, such as Tn3HoHo1 which carries a promoterless lac operon . This enables simultaneous gene disruption and transcriptional analysis.

  • Mutagenesis strategy:

    • Create a comprehensive library of transposon insertions throughout the ycjF gene.

    • Select for appropriate antibiotic resistance markers carried by the transposon.

    • Screen mutants for alterations in membrane localization or associated phenotypes.

  • Phenotypic analysis:

    • Examine cell envelope fractions using techniques such as silver staining and immunoblotting .

    • Categorize mutants into distinct phenotypic classes based on membrane protein localization patterns.

    • Correlate insertion positions with observed phenotypes to map functional domains.

  • Transcriptional analysis:

    • Measure β-galactosidase activity in clones containing lacZ transcriptional fusions to identify promoters and regulatory regions .

    • Determine the direction of transcription across the ycjF gene.

  • Complementation studies:

    • Create targeted ycjF-deficient mutants through homologous recombination.

    • Complement these mutants with wild-type ycjF to confirm gene-phenotype relationships .

This systematic approach will enable mapping of critical functional domains within the YcjF protein structure, providing insights into its membrane-associated functions.

What methods are most effective for studying YcjF in vivo expression during infection models?

Studying YcjF in vivo expression during infection requires specialized techniques to capture gene activity in host environments:

  • Antibiotic-based in vivo expression technology (IVET):

    • Create transcriptional fusions between ycjF promoter regions and a reporter gene like chloramphenicol acetyltransferase (cat) .

    • Introduce these constructs into the pathogenic E. coli strain.

    • Recover bacteria from infected host tissues (e.g., liver) and select for clones resistant to chloramphenicol in vivo but sensitive in vitro .

    • Confirm differential expression using reverse transcription-PCR to detect cat expression in vivo but not during in vitro growth .

  • Fluorescent reporter systems:

    • Create transcriptional fusions with fluorescent proteins like GFP.

    • Utilize intravital microscopy to visualize expression in real-time within live host tissues.

  • RNA-based approaches:

    • Perform RNA-seq on bacteria recovered directly from infection sites.

    • Compare transcriptional profiles with in vitro grown bacteria to identify differential expression patterns.

  • Chromosomal integration strategies:

    • Create stable reporter integrations using homologous recombination techniques .

    • Confirm integration by Southern blot hybridization .

These methods can reveal whether YcjF expression is specifically induced during infection, potentially indicating a role in pathogenesis or adaptation to host environments.

How should I design experiments to minimize bias when studying YcjF function?

Designing unbiased experiments for studying YcjF function requires rigorous attention to experimental controls and methodology:

  • Hypothesis formulation:

    • Develop clear, testable hypotheses based on preliminary data and prior research.

    • Be willing to revise hypotheses if experimental data contradicts expectations3.

  • Variable identification:

    • Clearly define independent variables (those manipulated by the experimenter) and dependent variables (those measured as outcomes)3.

    • Control for confounding variables through experimental design.

  • Blind analysis:

    • Implement blind experimental designs where the researcher analyzing data is unaware of which conditions apply to each sample3.

    • This is particularly important when evaluating phenotypic changes that might involve subjective assessment.

  • Replication strategy:

    • Include biological replicates (separate cultures/samples) to account for natural variation.

    • Perform technical replicates for each measurement to minimize random error3.

    • Run multiple independent experiments to ensure reproducibility.

  • Control inclusion:

    • Include positive and negative controls in all experiments.

    • Use vector-only controls for expression studies.

    • Include wild-type strains alongside mutants.

  • Quantitative measurements:

    • Prioritize quantitative data collection over qualitative assessments to reduce subjectivity3.

    • Develop standardized measurement protocols.

  • Error analysis:

    • Calculate and report measurement uncertainties following propagation of uncertainty principles3.

    • Distinguish between random errors (affecting precision) and systematic errors (affecting accuracy)3.

By implementing these strategies, researchers can minimize both conscious and unconscious bias in the study of YcjF function.

What are the optimal protocols for purifying recombinant YcjF while maintaining protein stability?

Purifying membrane proteins like YcjF requires specialized approaches to maintain stability:

Table 1: Comparison of Purification Methods for Recombinant YcjF

Purification MethodAdvantagesLimitationsBuffer RecommendationsYield Expectation
Affinity Chromatography (IMAC)High specificity, single-step enrichmentMay affect protein folding50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.05% DDMModerate (2-5 mg/L culture)
Size Exclusion ChromatographyRemoves aggregates, provides native state assessmentLow resolution for similar-sized contaminants20 mM HEPES pH 7.4, 150 mM NaCl, 0.03% DDM70-90% recovery from IMAC
Ion Exchange ChromatographyHigh resolution separationSalt sensitivity20 mM MES pH 6.5, 50-500 mM NaCl gradient, 0.05% DDMVariable (50-80% recovery)

Recommended Protocol:

  • Membrane isolation:

    • Harvest cells from optimal expression system (typically E. coli grown at 18°C post-induction).

    • Lyse cells using mechanical disruption (French press or sonication).

    • Isolate membrane fraction through ultracentrifugation (100,000 × g for 1 hour).

  • Solubilization:

    • Solubilize membranes in buffer containing mild detergents (0.5-1% DDM or LMNG).

    • Incubate with gentle agitation at 4°C for 1-2 hours.

    • Remove insoluble material by ultracentrifugation.

  • Purification sequence:

    • Perform IMAC purification using Ni-NTA or TALON resin.

    • Follow with size exclusion chromatography to remove aggregates.

    • Consider ion exchange as a final polishing step if necessary.

  • Stability considerations:

    • Maintain temperature at 4°C throughout purification.

    • Include glycerol (10%) to enhance stability.

    • Consider adding lipids (0.1-0.2 mg/mL) to stabilize the membrane protein.

    • Analyze protein stability using thermal shift assays to optimize buffer conditions.

This protocol typically yields 1-3 mg of purified YcjF protein per liter of E. coli culture with >90% purity as assessed by SDS-PAGE.

How can I accurately assess the membrane topology of YcjF?

Accurately determining YcjF membrane topology requires combining computational predictions with experimental validation:

  • Computational prediction approaches:

    • Utilize multiple topology prediction algorithms (TMHMM, HMMTOP, Phobius) and create a consensus model.

    • Identify potential transmembrane domains, cytoplasmic regions, and periplasmic loops.

    • Map conserved residues across the UPF0283 family to identify functionally important regions.

  • Experimental validation methods:

    • Cysteine accessibility scanning: Introduce single cysteine residues throughout the protein and test their accessibility to membrane-impermeable sulfhydryl reagents.

    • Protease protection assays: Treat membrane vesicles with proteases and identify protected fragments through mass spectrometry.

    • Reporter fusion approach: Create systematic fusions with reporter proteins (GFP, PhoA, LacZ) to determine cytoplasmic versus periplasmic localization of specific domains.

  • Advanced structural techniques:

    • Cryo-electron microscopy: For high-resolution structural determination.

    • Hydrogen-deuterium exchange mass spectrometry: To identify solvent-exposed regions.

    • Solid-state NMR: For atomic-level structural information within the membrane environment.

  • Validation in multiple systems:

    • Compare topology in native E. coli membranes versus reconstituted proteoliposomes.

    • Assess whether topology is affected by protein overexpression.

Through this integrated approach, researchers can develop a reliable topology model of YcjF that serves as a foundation for structure-function studies and targeted mutagenesis.

What statistical approaches are most appropriate for analyzing YcjF mutant phenotypes?

Analyzing YcjF mutant phenotypes requires robust statistical approaches to ensure reliable interpretation:

  • Experimental design considerations:

    • Implement randomized complete block designs to control for batch effects.

    • Calculate appropriate sample sizes through power analysis to detect expected effect sizes.

    • Include both technical and biological replicates.

  • Descriptive statistics:

    • Report means, standard deviations, and standard errors for all measurements.

    • Create visualization tools (box plots, scatter plots) to display data distribution.

  • Inferential statistics:

    • For comparing two conditions: Use Student's t-test (parametric) or Mann-Whitney U test (non-parametric).

    • For multiple comparisons: Apply ANOVA with appropriate post-hoc tests (Tukey, Bonferroni, or Dunnett's).

    • Control for multiple testing using false discovery rate (FDR) correction when analyzing multiple phenotypes.

  • Correlation analyses:

    • Use Pearson's or Spearman's correlation to identify relationships between different phenotypic parameters.

    • Apply principal component analysis (PCA) to identify patterns in multi-dimensional phenotypic data.

  • Regression models:

    • Develop predictive models relating specific mutations to phenotypic outcomes.

    • Consider generalized linear models for non-normally distributed data.

  • Uncertainty analysis:

    • Calculate and propagate measurement uncertainties following appropriate formulas (square root of the sum of squares for independent variables)3.

    • Distinguish between random and systematic errors to improve future experimental designs.

  • Data presentation:

    • Present data with clear indication of statistical significance.

    • Include effect sizes alongside p-values to indicate biological relevance.

These approaches ensure rigorous analysis of YcjF mutant phenotypes while minimizing both Type I (false positive) and Type II (false negative) errors.

How can I identify and resolve contradictory data when studying YcjF function in different experimental systems?

Identifying and resolving contradictory data when studying YcjF across different experimental systems requires a systematic approach:

This systematic approach transforms contradictory data from a research obstacle into an opportunity for deeper understanding of YcjF's multifaceted functions.

What bioinformatic approaches can predict functional domains and interaction partners of YcjF?

Leveraging bioinformatic approaches to predict YcjF functional domains and interaction partners involves multiple computational strategies:

  • Sequence-based analysis:

    • Perform multiple sequence alignments of UPF0283 family members to identify conserved residues.

    • Apply conservation scoring methods (ConSurf, Evolutionary Trace) to map functionally important residues.

    • Use domain prediction tools (InterProScan, SMART) to identify characterized functional domains.

  • Structural prediction:

    • Generate 3D structural models using template-based (SWISS-MODEL) or ab initio (AlphaFold2) approaches.

    • Analyze structural features such as surface cavities, electrostatic potentials, and hydrophobic patches.

    • Identify potential ligand-binding sites using methods like CASTp or SiteMap.

  • Interaction prediction:

    • Apply protein-protein interaction prediction tools (STRING, STITCH) to identify potential binding partners.

    • Use co-expression network analysis to identify genes with similar expression patterns across conditions.

    • Analyze genomic context conservation (gene neighborhood) to identify functionally related genes.

  • Functional annotation transfer:

    • Identify distant homologs with known functions through sensitive sequence comparison methods (HHpred, HMMER).

    • Analyze shared structural features with functionally characterized proteins.

    • Implement function prediction algorithms that integrate multiple data types (sequence, structure, genomic context).

  • Experimental verification design:

    • Prioritize predicted interaction partners for co-immunoprecipitation validation.

    • Design site-directed mutagenesis experiments targeting predicted functional residues.

    • Develop binding assays for putative ligands identified through cavity analysis.

By integrating these bioinformatic approaches, researchers can generate testable hypotheses about YcjF function and interaction partners, guiding experimental designs toward the most promising directions.

What are the major knowledge gaps in our understanding of YcjF function and expression?

Despite ongoing research, several critical knowledge gaps remain in our understanding of the UPF0283 membrane protein YcjF:

  • Functional characterization:

    • The precise biological function of YcjF remains largely unknown, with limited experimental validation of predicted functions.

    • Whether YcjF serves primarily structural, regulatory, or enzymatic roles in bacterial membranes is unclear.

    • The conditions under which YcjF expression is essential versus dispensable require further investigation.

  • Structural information:

    • High-resolution structural data for YcjF is currently lacking, limiting structure-based functional predictions.

    • The membrane topology model requires experimental validation across multiple conditions.

    • Conformational changes that might occur during protein function remain uncharacterized.

  • Regulation mechanisms:

    • Transcriptional and translational regulation of ycjF under different environmental conditions remains poorly understood.

    • The role of YcjF in stress responses or adaptation to environmental changes requires further exploration.

    • Whether ycjF is specifically induced during host infection, similar to other E. coli genes identified through in vivo expression studies, needs investigation .

  • Interaction network:

    • The protein-protein interaction partners of YcjF are largely unknown.

    • Potential involvement in multi-protein complexes has not been systematically investigated.

    • Small molecule binding partners or substrates have not been definitively identified.

  • Clinical relevance:

    • The potential role of YcjF in pathogenesis, antibiotic resistance, or biofilm formation requires further study.

    • Strain-specific variations in YcjF structure and function across pathogenic and non-pathogenic E. coli require systematic comparison.

Addressing these knowledge gaps would significantly advance our understanding of YcjF's role in bacterial physiology and potentially reveal new targets for antimicrobial intervention.

What emerging technologies show promise for advancing YcjF research?

Several emerging technologies demonstrate significant potential for accelerating research on the UPF0283 membrane protein YcjF:

  • Structural biology advancements:

    • Cryo-electron microscopy with improved resolution for membrane proteins.

    • Microcrystal electron diffraction (MicroED) for proteins resistant to traditional crystallization.

    • Integrative structural biology approaches combining multiple experimental data types.

  • Genetic manipulation tools:

    • CRISPR-Cas9 genome editing for precise chromosomal modifications.

    • Base editing and prime editing technologies for introducing specific mutations without double-strand breaks.

    • Multiplexed functional genomics to systematically assess genetic interactions.

  • Protein analysis innovations:

    • Hydrogen-deuterium exchange mass spectrometry with improved sensitivity for membrane proteins.

    • Single-molecule fluorescence techniques for real-time observation of protein dynamics.

    • Nanobody-based probes for targeting specific conformational states.

  • Computational advances:

    • Deep learning approaches (such as AlphaFold2) for accurate protein structure prediction.

    • Molecular dynamics simulations with improved force fields for membrane environments.

    • Network analysis tools integrating multi-omics data to predict protein function.

  • High-throughput phenotyping:

    • Automated growth and phenotyping systems for rapid characterization of mutant strains.

    • Microfluidic devices for single-cell analysis of protein expression and localization.

    • Label-free biosensors for detecting protein-protein and protein-ligand interactions.

  • In vivo analysis techniques:

    • Advanced in vivo expression technology systems with improved sensitivity .

    • Tissue-clearing methods coupled with light-sheet microscopy for visualizing bacterial proteins in infected tissues.

    • Intravital microscopy for real-time observation of protein dynamics during infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.