Recombinant Escherichia coli O7:K1 UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure the contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your specifications.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
yihY; ECIAI39_3114; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
yihY
Target Protein Sequence
MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI DSALNAIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is currently known about the YihY (UPF0761) membrane protein in E. coli O7:K1?

YihY belongs to the uncharacterized protein family UPF0761 found in E. coli O7:K1. As indicated in the literature, it is classified among uncharacterized BrkB/YihY/UPF0761 proteins . The UPF designation signifies that its precise function remains undetermined. While structural predictions suggest it is a membrane-associated protein, its specific biochemical activities, regulatory roles, and physiological functions are yet to be fully elucidated. Research on other membrane proteins in E. coli K1 strains, such as OmpA, has revealed significant roles in host-pathogen interactions , suggesting YihY may also have important functional properties worth investigating.

What expression systems are recommended for producing recombinant YihY protein?

For efficient expression of membrane proteins from E. coli O7:K1, E. coli K-12 strains are frequently employed as heterologous hosts. Research on O7 lipopolysaccharide expression indicates that while E. coli K-12 can express proteins from E. coli K1, expression levels are often "considerably lower than that produced by the wild-type strain" . Therefore, optimization strategies should include:

  • Vector selection: Use low-copy plasmids with tunable promoters to control expression levels

  • Growth conditions: Lower temperatures (16-25°C) often improve membrane protein folding

  • Host strain selection: Consider C41(DE3) or C43(DE3) strains specifically developed for membrane protein expression

  • Induction parameters: Optimize inducer concentration and induction timing

Testing multiple expression conditions with small-scale cultures is recommended before scaling up production.

What purification approaches are most effective for YihY membrane protein?

Purification of YihY requires specialized approaches due to its membrane localization:

Purification StepRecommended MethodsKey Considerations
Cell disruptionFrench press or sonicationGentle disruption to preserve protein structure
Membrane isolationDifferential ultracentrifugationTypically 100,000×g to pellet membranes
SolubilizationDetergent screening (DDM, LDAO, CHAPS)Test multiple detergents and concentrations
Affinity purificationIMAC for His-tagged constructsInclude detergent in all buffers
Size exclusionSuperdex 200 or similarAssess oligomeric state
Protein concentrationCentrifugal concentratorsUse appropriate MWCO to prevent concentration of empty micelles

For structural studies, detergent exchange to more suitable amphiphiles (e.g., nanodisc incorporation) may be necessary during later purification stages.

How can I verify the correct folding and function of purified YihY protein?

Since YihY is uncharacterized, verification of proper folding must rely on biophysical rather than activity-based methods:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to evaluate homogeneity and oligomeric state

  • Thermal shift assays to determine protein stability

  • Limited proteolysis to probe for well-folded domains versus unstructured regions

  • Tryptophan fluorescence spectroscopy to evaluate tertiary structure

Once functional assays are developed based on bioinformatic predictions, these can provide additional confirmation of proper folding.

What approaches are recommended for functionally characterizing YihY?

A comprehensive strategy for characterizing YihY would include:

  • Comparative genomics analysis: Identify conserved genomic context and potential functional partners across bacterial species

  • Gene knockout studies: Generate ΔyihY strains and characterize phenotypes across multiple growth conditions, similar to approaches used for transcription factor YdcI where "the ydcI deletion strain showed significant growth defects compared to the wild type" at non-neutral pH

  • Protein-protein interaction studies: Use co-immunoprecipitation or bacterial two-hybrid systems to identify interaction partners

  • Transcriptomic analysis: Compare gene expression between wild-type and knockout strains using RNA-seq

  • Metabolomic profiling: Identify metabolic pathways affected by YihY absence

This multi-faceted approach has proven effective for characterizing previously uncharacterized proteins, as demonstrated by the successful identification of functions for novel transcription factors in E. coli .

How might YihY affect virulence in pathogenic E. coli O7:K1 strains?

To investigate potential virulence roles of YihY, consider these methodological approaches:

  • Invasion assays: Compare invasion efficiency of wild-type versus ΔyihY mutants in relevant host cell models. This approach parallels studies with OmpA, where "inhibition of invasion by cytochalasin D or PKC-α inhibitory peptide or Wortmannin significantly reduced the up-regulation of ICAM-1 by OmpA+ E. coli"

  • Animal infection models: Assess colonization, persistence, and pathogenesis in appropriate animal models

  • Host response analysis: Measure host cell responses (cytokine production, adhesion molecule expression) following exposure to wild-type versus ΔyihY strains

  • Bacterial survival assays: Test resistance to host defense mechanisms (complement, antimicrobial peptides) in the presence or absence of YihY

  • Co-infection studies: Determine if YihY affects competition with other microorganisms in host environments

A carefully designed set of experiments focusing on these aspects would help establish whether YihY contributes to virulence, potentially through mechanisms similar to other membrane proteins like OmpA which "selectively up-regulates the expression of ICAM-1 in HBMEC only invaded by the bacteria" .

What computational approaches can predict structure and function of YihY?

For uncharacterized membrane proteins like YihY, computational predictions provide valuable starting points:

Computational ApproachToolsExpected Outcomes
Sequence analysisBLAST, HHpred, HMMERIdentification of distant homologs with known functions
Structural predictionAlphaFold2, RoseTTAFold3D structural models with confidence scores
Transmembrane topologyTMHMM, TOPCONSPrediction of membrane-spanning regions
Functional domain predictionInterProScan, PfamIdentification of conserved domains
Genomic context analysisSTRING, GeConTIdentification of functionally related genes
Feature extraction methodsAveraging block, DWT, DCT, HOG, Pse-PSSMExtraction of sequence features for machine learning approaches

The combination of multiple approaches increases confidence in predictions, as each method has unique strengths and limitations. Machine learning approaches using deep network architectures have shown promise for membrane protein classification .

How can I determine if YihY has regulatory functions in E. coli gene expression?

To investigate potential regulatory roles, implement these experimental approaches:

  • Transcriptome analysis: Compare RNA-seq profiles between wild-type and ΔyihY strains under various conditions, similar to studies that found "the expression of the operon yiaK-S was highly up-regulated in the [yiaJ] deletion strain"

  • DNA-binding assays: Test purified YihY for DNA-binding activity using electrophoretic mobility shift assays (EMSA)

  • Chromatin immunoprecipitation: If DNA binding is observed, perform ChIP-seq to identify genomic binding sites, following approaches used for uncharacterized transcription factors where "ChIP-exo experiments for YdcI were conducted at different pH conditions"

  • Reporter gene assays: Construct reporter fusions with promoters of differentially expressed genes to validate direct regulatory effects

  • Protein-protein interaction studies: Investigate interactions with known transcriptional machinery components

If YihY does have regulatory functions, these approaches should reveal its regulon and mechanism of action.

What factors should be considered when designing gene knockout experiments for yihY?

When designing knockout experiments:

  • Knockout strategy selection:

    • λ Red recombineering for scarless deletion

    • CRISPR-Cas9 for precise genomic modifications

    • Ensure knockout doesn't affect neighboring genes through polar effects

  • Strain background considerations:

    • Use of laboratory-adapted versus clinical E. coli O7:K1 strains

    • Potential redundancy with other genes affecting interpretation

  • Complementation controls:

    • Expression of yihY from plasmids with controlled expression levels

    • Use of native versus artificial promoters

    • Inclusion of epitope tags for verification

  • Growth condition variables:

    • Test multiple media compositions resembling different host environments

    • Vary temperature, pH, and oxygen tension

    • Include stress conditions (nutrient limitation, antimicrobial exposure)

  • Verification of knockout:

    • PCR verification of gene deletion

    • RNA-seq or RT-PCR confirmation of transcript absence

    • Western blot verification of protein absence

Similar knockout approaches revealed growth defects for the transcription factor YdcI deletion strain at non-neutral pH conditions, providing insights into its physiological role .

How can I overcome solubility challenges with YihY membrane protein?

Membrane protein solubility presents significant challenges. Consider this systematic troubleshooting approach:

ChallengeRecommended SolutionsSuccess Indicators
Low expression levelsTest different promoters, strains, and expression temperaturesDetectable bands on Western blot
Protein aggregationScreen multiple detergents and detergent:protein ratiosMonodisperse peak on SEC
Protein instabilityOptimize buffer conditions (pH, salt, additives)Increased thermal stability
Loss during purificationTest different affinity tags and positionsImproved yield and purity
Functional inactivationConsider native lipid addition or nanodisc incorporationRetention of activity/structure

For E. coli O7 membrane components, previous research has demonstrated that extraction techniques significantly impact yield and functionality, as "silver-stained polyacrylamide gels of total membranes extracted with hot phenol showed O side chain material" . Therefore, extraction and solubilization conditions must be carefully optimized.

What controls are essential when investigating potential interactions of YihY with other cellular components?

Robust controls are critical for interaction studies:

  • For protein-protein interaction studies:

    • Negative controls: Non-interacting proteins of similar size/properties

    • Competition controls: Unlabeled protein to compete with labeled protein

    • Domain mutants: Targeted mutations in predicted interaction domains

    • Reciprocal co-immunoprecipitation to confirm interactions

  • For potential DNA interaction studies:

    • Scrambled DNA sequences as negative controls

    • Competition with specific versus non-specific DNA

    • Positive controls using known DNA-binding proteins

    • DNase I treatment to verify DNA dependency

  • For lipid interaction studies:

    • Liposomes of varying compositions

    • Controls with other membrane proteins of known lipid preferences

    • Detergent-only controls to account for detergent effects

  • Technical controls:

    • Input samples for immunoprecipitation experiments

    • Tag-only controls for affinity purification

    • Empty vector controls for expression studies

These controls help distinguish specific interactions from experimental artifacts, similar to approaches used in studying OmpA interactions with host receptors .

How should RNA-seq data be analyzed to identify genes potentially regulated by YihY?

RNA-seq analysis for YihY studies should follow this workflow:

  • Quality control and preprocessing:

    • Filter low-quality reads (Phred score < 20)

    • Trim adapters and low-quality bases

    • Filter rRNA reads

  • Read mapping and quantification:

    • Map to E. coli O7:K1 reference genome using HISAT2 or STAR

    • Quantify gene expression using featureCounts or HTSeq

    • Normalize counts (TPM, RPKM, or using DESeq2 normalization)

  • Differential expression analysis:

    • Apply DESeq2 or edgeR with appropriate design formula

    • Use adjusted p-value cutoff (typically <0.05)

    • Apply fold-change threshold (|log2FC| > 1)

  • Functional interpretation:

    • Gene Ontology enrichment analysis

    • KEGG pathway analysis

    • Gene set enrichment analysis (GSEA)

    • Motif discovery in promoters of differentially expressed genes

  • Validation:

    • qRT-PCR for selected genes

    • Reporter gene assays for key targets

    • Comparison with other relevant datasets

This approach parallels methods used to identify the regulon of YiaJ, where "expression of the operon yiaK-S was highly up-regulated in the deletion strain" .

What statistical approaches are appropriate for analyzing phenotypic differences between wild-type and ΔyihY strains?

Statistical analysis of phenotypic data should be tailored to the specific experiment:

Experiment TypeRecommended Statistical ApproachKey Considerations
Growth curvesNonlinear regression, comparison of fitted parameters (e.g., max growth rate, lag time)Account for non-independence of time points
Survival assaysKaplan-Meier curves with log-rank testConsider right-censored data
Virulence assaysANOVA or t-tests with multiple testing correctionCheck assumptions of normality and equal variance
Multivariate phenotypic dataPrincipal component analysis, hierarchical clusteringAppropriate scaling of variables
High-throughput phenotypic screensLinear mixed models, empirical Bayes methodsAccount for batch effects

For all analyses:

  • Include both biological and technical replicates

  • Report effect sizes along with p-values

  • Use appropriate corrections for multiple testing (e.g., Benjamini-Hochberg)

  • Validate findings with independent experiments

How can discrepancies between computational predictions and experimental results for YihY be reconciled?

When facing contradictions between computational predictions and experimental results:

  • Reassess computational predictions:

    • Check confidence scores and reliability metrics

    • Run alternative prediction algorithms

    • Consider if predictions are based on distant homologs

    • Evaluate if the protein family is well-represented in training datasets

  • Critically evaluate experimental design:

    • Assess whether experimental conditions match physiological context

    • Consider if tags or fusion partners might affect function

    • Evaluate sensitivity and specificity of assays

    • Examine potential off-target effects in genetic studies

  • Consider biological explanations:

    • Moonlighting functions (multiple distinct roles)

    • Context-dependent activity

    • Post-translational modifications affecting function

    • Presence/absence of cofactors or interaction partners

  • Design targeted experiments:

    • Test specific aspects of computational predictions

    • Vary experimental conditions based on predictions

    • Design domain-specific mutants to test structural predictions

Reconciling such discrepancies often leads to novel insights, as demonstrated in the study of uncharacterized transcription factors where experimental approaches revealed functions that "YiaJ is involved in the utilization of l-ascorbate, YdcI is involved in proton and acetate metabolism, and YeiE is involved in iron uptake under iron-limited conditions" .

What emerging technologies show promise for advancing YihY research?

Several cutting-edge technologies could accelerate YihY characterization:

  • Advanced structural biology methods:

    • Cryo-EM for high-resolution membrane protein structures without crystallization

    • Hydrogen-deuterium exchange mass spectrometry for dynamics and interaction mapping

    • Integrative structural biology combining multiple experimental data types

  • Functional genomics approaches:

    • CRISPR interference/activation for tunable gene expression modulation

    • Transposon sequencing (Tn-seq) for high-throughput phenotyping

    • Ribosome profiling to assess translational impacts

  • Advanced biophysical techniques:

    • Single-molecule tracking for in vivo dynamics

    • Super-resolution microscopy for precise localization

    • Native mass spectrometry for intact membrane protein complexes

  • Computational advances:

    • Deep learning for membrane protein function prediction

    • Extended molecular dynamics simulations for conformational sampling

    • Artificial intelligence approaches that integrate diverse data types for functional prediction, similar to "dynamic deep network architecture based on lifelong learning" for membrane protein classification

These technologies provide complementary approaches that together can accelerate the functional characterization of previously uncharacterized membrane proteins like YihY.

How might characterization of YihY contribute to broader understanding of E. coli pathogenesis?

Understanding YihY function could advance E. coli pathogenesis research in several ways:

  • Host-pathogen interaction insights: If YihY is involved in host cell interactions, similar to OmpA which "selectively up-regulates the expression of ICAM-1 in HBMEC" , it could reveal new mechanisms of bacterial invasion or immune evasion

  • Virulence regulation: YihY might participate in regulatory networks controlling expression of virulence factors in response to host environments

  • Membrane adaptation mechanisms: Characterization could reveal how E. coli O7:K1 adapts its membrane composition or structure during infection

  • Novel therapeutic targets: If YihY proves essential for pathogenesis, it could represent a target for anti-virulence therapies

  • Evolutionary insights: Comparative analysis across E. coli pathotypes could illuminate how membrane protein specialization contributes to pathogenic adaptation

The methodological approaches used to characterize O7 LPS expression in E. coli K-12, where "deletion and transposition experiments identified a region of about 17 kilobase pairs which is essential for the expression of O7 LPS" , provide templates for investigating how YihY might contribute to E. coli O7:K1 membrane biology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.