Recombinant Escherichia coli O7:K1 Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
zntB; ECIAI39_1692; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL
Uniprot No.

Target Background

Function
Mediates the efflux of zinc ions.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ZntB protein and what is its primary function in bacterial cells?

ZntB is a zinc transport protein belonging to the CorA family of cation transporters, widely distributed among eubacteria. Unlike other members of this family that primarily transport magnesium, ZntB functions specifically as a zinc efflux pathway. It plays a crucial role in zinc homeostasis in enteric bacteria such as Salmonella enterica serovar Typhimurium and Escherichia coli by mediating the extrusion of zinc ions from the cell .

The ZntB protein's primary function is evidenced through multiple experimental approaches:

  • Mutation studies showing increased sensitivity to zinc and cadmium

  • Direct transport assays demonstrating decreased zinc efflux in zntB mutants

  • Complementation studies restoring zinc resistance with plasmid-encoded zntB

This efflux function is particularly important for bacterial survival in environments with elevated zinc concentrations, as it helps maintain intracellular zinc levels within a narrow physiological range.

How does ZntB differ structurally and functionally from other metal transporters?

ZntB belongs to the CorA family of cation transporters but exhibits distinct functional properties that differentiate it from other metal transporters:

Structural and Functional Comparison:

CharacteristicZntBCorA (Mg²⁺ transporter)ZntA/ZitB (Zn²⁺ transporters)
FamilyCorA familyCorA familyP-type ATPase/CDF family
Primary substrateZn²⁺Mg²⁺Zn²⁺
Direction of transportEffluxBidirectional (primarily influx)Efflux
Response to metal excessFunctional roleNot primary functionFunctional role
Amino acid sequence327 amino acids in E. coli O7:K1Varies by speciesVaries by system

What are the optimal experimental designs for studying ZntB function in bacterial systems?

Designing experiments to study ZntB function requires careful consideration of multiple factors. Based on successful approaches documented in the literature, the following experimental designs are recommended:

Genetic Disruption Studies:

  • Generate zntB mutants using allelic replacement techniques (e.g., insertion of antibiotic resistance cassettes)

  • Confirm disruption via PCR and/or sequencing

  • Assess phenotypes using:

    • Disk diffusion assays with various metal ions (Zn²⁺, Cd²⁺, Co²⁺, Ni²⁺, Mn²⁺)

    • Growth curves in media containing different zinc concentrations

    • Complementation with plasmid-encoded wild-type zntB

Transport Assays:

  • Use radioisotope ⁶⁵Zn²⁺ to directly measure transport activity

  • For uptake assays: expose cells to ⁶⁵Zn²⁺ and measure accumulation over time

  • For efflux assays:

    • Preload cells with ⁶⁵Zn²⁺

    • Resuspend in assay buffer containing unlabeled zinc

    • Measure remaining intracellular ⁶⁵Zn²⁺ at timed intervals

Statistical Considerations:

  • Include adequate biological replicates (minimum n=3)

  • Apply appropriate statistical tests (t-tests for pairwise comparisons, ANOVA for multiple conditions)

  • Calculate effect sizes to quantify the magnitude of differences

Critical controls should include wild-type strains, mutants in other known zinc transport systems (znuABC, zupT, zntA, zitB), and appropriate vector-only controls for complementation studies. This comprehensive approach allows for robust characterization of ZntB function in various genetic backgrounds.

How should researchers optimize recombinant expression of E. coli O7:K1 ZntB protein?

Optimizing recombinant expression of ZntB requires addressing several key parameters to maximize protein yield and functionality:

Expression System Selection:

System ComponentRecommended OptionsRationale
Host strainBL21(DE3), SHuffle T7, C41(DE3), C43(DE3)Specialized for membrane/difficult proteins
VectorpET series (medium copy), pBADTunable expression levels
PromoterT7-lac, araBAD, trcBalance between yield and solubility
TagsHis6, GST, MBPFacilitate purification; enhance solubility

Expression Conditions to Prevent Inclusion Body Formation:

  • Reduce expression rate:

    • Lower induction temperature (16-25°C)

    • Decrease inducer concentration (0.01-0.1 mM IPTG or 0.002-0.02% arabinose)

    • Use slower-acting promoters

  • Consider specialized strains:

    • C41(DE3)/C43(DE3) for toxic membrane proteins

    • SHuffle strains for disulfide bond formation

    • Lemo21(DE3) for tunable T7 lysozyme expression via the rhBAD promoter

  • Apply solubility-enhancing strategies:

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J-GrpE)

    • Include compatible solutes (5-10% glycerol, 1M sorbitol, 0.5M trehalose)

    • Use fusion partners (MBP, SUMO, TrxA)

For ZntB specifically, researchers should be aware that as a membrane-associated transporter, it may require special considerations for maintaining structure and function. Detergent screening (e.g., DDM, LDAO, OG) may be necessary for solubilization if the full-length protein is desired. Alternatively, consider expressing soluble domains for structural studies if the full transporter proves challenging .

What methodologies are most effective for studying ZntB's role in zinc homeostasis networks?

Understanding ZntB's role within the broader zinc homeostasis network requires integrative approaches:

Systems Biology Approaches:

  • Transcriptomics:

    • RNA-Seq to identify genes co-regulated with zntB under zinc stress

    • qRT-PCR validation of key regulatory relationships

    • ChIP-Seq to identify transcription factor binding sites in the zntB promoter

  • Metalloproteomics:

    • ICP-MS to quantify total cellular zinc content

    • Fluorescent zinc probes to track intracellular zinc distribution

    • Synchrotron X-ray fluorescence microscopy for subcellular localization

  • Genetic interaction mapping:

    • Create double/triple mutants with other zinc transporters (znuABC, zupT, zntA, zitB)

    • Perform growth and transport assays under varying zinc conditions

    • Calculate genetic interaction scores to identify synergistic or antagonistic relationships

Advanced Phenotypic Characterization:

  • Microfluidic single-cell analysis to measure heterogeneity in:

    • Zinc content (using fluorescent sensors)

    • zntB expression (using reporter fusions)

    • Growth rates under zinc stress

  • Competition assays between wild-type and zntB mutants in:

    • Defined media with controlled zinc levels

    • Complex environments mimicking natural habitats

    • In vivo infection models (for pathogenic strains)

For analyzing complex datasets, implement multivariate statistical methods and network analysis algorithms to identify significant interactions and regulatory patterns . These integrative approaches can reveal how ZntB coordinates with other zinc transport systems to maintain homeostasis under various environmental conditions.

How can researchers investigate the structural mechanism of zinc transport by ZntB?

Elucidating the structural basis of ZntB-mediated zinc transport requires sophisticated biochemical and biophysical approaches:

Structural Determination Methods:

  • X-ray crystallography:

    • Purify ZntB in appropriate detergent micelles

    • Screen crystallization conditions systematically

    • Consider lipidic cubic phase crystallization for membrane proteins

  • Cryo-electron microscopy:

    • Prepare ZntB in nanodiscs or amphipols

    • Use direct electron detectors and high-end microscopes

    • Employ 3D classification to identify different conformational states

  • Nuclear magnetic resonance (for domains):

    • Express isotopically labeled soluble domains

    • Perform multidimensional NMR experiments

    • Determine solution structure and dynamics

Functional Analysis of Transport Mechanism:

  • Site-directed mutagenesis of predicted zinc-binding residues:

    • Target conserved histidine, cysteine, aspartate residues

    • Create alanine substitutions

    • Assess impact on transport activity and zinc binding

  • Accessibility studies:

    • Introduce cysteine residues at strategic positions

    • Probe with thiol-reactive reagents

    • Map the transport pathway and conformational changes

  • Transport kinetics:

    • Measure concentration-dependent zinc transport

    • Determine Km and Vmax values

    • Assess effects of pH, membrane potential, and other cations

Computational methods can complement experimental approaches through homology modeling, molecular dynamics simulations, and quantum mechanical calculations of zinc coordination geometry . This multi-faceted approach can reveal how ZntB selectively binds and transports zinc ions across the bacterial membrane.

What methods are most reliable for quantifying ZntB-mediated zinc transport in live bacterial cells?

Accurate quantification of ZntB-mediated zinc transport requires methods that can distinguish this specific pathway from other transport systems:

Radioisotope-Based Methods:

  • ⁶⁵Zn²⁺ efflux assay:

    • Preload cells with ⁶⁵Zn²⁺ (typically 5 μM for 20 minutes)

    • Collect cells on nitrocellulose filters

    • Resuspend in assay buffer containing 10 μM unlabeled ZnSO₄

    • Sample at defined time points (0, 1, 2, 5, 10, 15 minutes)

    • Measure remaining intracellular ⁶⁵Zn²⁺ by gamma counting

  • ⁶⁵Zn²⁺ accumulation in membrane vesicles:

    • Prepare inside-out or right-side-out membrane vesicles

    • Energize with ATP or an artificial proton gradient

    • Measure zinc transport across the vesicle membrane

    • Use specific inhibitors to distinguish transport systems

Real-Time Fluorescence Methods:

  • Genetically encoded zinc sensors:

    • Express FRET-based or single-fluorophore zinc sensors

    • Calibrate with zinc ionophores and chelators

    • Measure fluorescence changes in response to zinc challenges

    • Use zntB mutants as controls

  • Cell-permeable fluorescent zinc probes:

    • Load cells with probes like FluoZin-3 AM

    • Monitor fluorescence using flow cytometry or microscopy

    • Calculate zinc efflux rates from fluorescence decay curves

Inductively Coupled Plasma Mass Spectrometry (ICP-MS):

  • Culture cells in defined media with controlled zinc levels

  • Harvest at specific time points after zinc challenge

  • Wash thoroughly to remove extracellular zinc

  • Digest cells with nitric acid

  • Analyze zinc content by ICP-MS

  • Compare wild-type and zntB mutant strains

When employing these methods, researchers should consider the following controls:

  • Include zntA and zitB mutants to account for other efflux systems

  • Use competitive metal ions to assess transport specificity

  • Include metabolic inhibitors to distinguish active from passive transport

What are the best approaches for analyzing data from ZntB transport experiments?

Proper data analysis is crucial for interpreting zinc transport experiments accurately:

Kinetic Analysis:

  • For efflux data:

    • Plot percentage of initial ⁶⁵Zn²⁺ remaining versus time

    • Fit to first-order exponential decay: Zn(t) = Zn₀e^(-kt)

    • Calculate efflux rate constant (k) and half-time (t₁/₂)

    • Compare rates between wild-type, mutant, and complemented strains

  • For uptake studies (if applicable):

    • Plot zinc accumulation versus time

    • For initial rates, use linear regression on early time points

    • For saturation kinetics, fit to Michaelis-Menten equation:
      V = Vmax[Zn²⁺]/(Km + [Zn²⁺])

Statistical Considerations:

  • Experimental design:

    • Ensure adequate biological replicates (n≥3)

    • Include technical replicates within each biological replicate

    • Apply power analysis to determine appropriate sample size

  • Statistical tests:

    • For comparing two conditions: Student's t-test or Mann-Whitney U test

    • For multiple conditions: ANOVA with appropriate post-hoc tests

    • For non-normally distributed data: Consider non-parametric alternatives

  • Reporting:

    • Include measures of central tendency (mean, median) AND dispersion (SD, SEM)

    • Report exact p-values rather than thresholds

    • Calculate and report effect sizes (Cohen's d, η²)

Visualization Strategies:

  • Time course data:

    • Line graphs with error bars

    • Semi-log plots to visualize exponential processes

    • Include individual data points when sample size is small

  • Comparative analysis:

    • Bar graphs with significance indicators

    • Box plots to show distribution

    • Heat maps for multiple conditions/mutants

When analyzing complex datasets involving multiple zinc transport systems, consider multivariate approaches or principal component analysis to identify patterns and relationships that might not be apparent in univariate analyses .

How can researchers reconcile contradictory data regarding ZntB function in different bacterial strains?

When faced with contradictory results regarding ZntB function across different bacterial strains, researchers should employ a systematic approach to reconcile these discrepancies:

Sources of Variation to Consider:

VariablePotential ImpactInvestigation Method
Genetic backgroundCompensatory pathwaysGenomic sequencing, transcriptomics
Growth conditionsExpression differencesStandardize media, growth phase
Experimental methodsSensitivity disparitiesCross-validate with multiple techniques
ZntB sequence variantsFunctional differencesComparative sequence analysis
Regulatory differencesExpression timing/levelPromoter analysis, reporter studies

Reconciliation Strategies:

  • Cross-strain validation:

    • Transfer the same zntB allele to multiple genetic backgrounds

    • Compare phenotypes under identical conditions

    • Use complementation studies with various zntB alleles

  • Systematic meta-analysis:

    • Catalog experimental conditions and results across studies

    • Identify consistent patterns and outliers

    • Apply statistical methods to quantify heterogeneity

  • Genomic context analysis:

    • Compare genome neighborhoods around zntB locus

    • Identify potential regulatory elements

    • Screen for interacting proteins unique to specific strains

  • Hybrid approaches:

    • Create chimeric proteins with domains from different strains

    • Test functionality in controlled genetic backgrounds

    • Map strain-specific differences to protein domains

A particularly powerful approach is to conduct parallel experiments in multiple strains simultaneously under identical conditions, which can reveal strain-specific effects while controlling for methodological variables. When differences persist, they should be viewed as potentially informative about strain-specific adaptations in zinc homeostasis rather than simply experimental inconsistencies .

What are the most rigorous methods for validating hypotheses about ZntB regulation and activity?

Validating hypotheses about ZntB regulation and activity requires multiple independent lines of evidence:

Transcriptional Regulation Validation:

  • Primary evidence:

    • qRT-PCR to measure zntB expression under various conditions

    • Reporter fusions (lacZ, gfp) to monitor promoter activity

    • Northern blotting to verify transcript size and abundance

  • Mechanistic validation:

    • Promoter dissection with targeted mutations

    • Electrophoretic mobility shift assays (EMSA) with putative regulators

    • Chromatin immunoprecipitation (ChIP) to identify binding sites in vivo

    • Genetic deletion of suspected regulatory proteins

Protein Activity Validation:

  • Direct functional assays:

    • Radioisotope transport studies (⁶⁵Zn²⁺)

    • Zinc-sensitive fluorescent reporters

    • ICP-MS quantification of cellular zinc content

  • Structure-function studies:

    • Site-directed mutagenesis of predicted functional residues

    • Protein-ligand binding assays (isothermal titration calorimetry, microscale thermophoresis)

    • Accessibility studies with cysteine-specific reagents

Integrated Physiological Validation:

  • Growth phenotypes:

    • Survival under zinc stress conditions

    • Competition assays between mutant and wild-type strains

    • Phenotype microarrays to assess broader metabolic impacts

  • System-level approaches:

    • Multi-omics integration (transcriptomics, proteomics, metallomics)

    • Network analysis to position ZntB in the zinc homeostasis network

    • Mathematical modeling to predict system behavior

For each hypothesis, researchers should design experiments that can potentially falsify their predictions, not merely confirm them. Additionally, validation should occur at multiple levels of biological organization—from molecular interactions to whole-cell physiology—providing converging lines of evidence .

What are common problems when working with recombinant ZntB and how can they be addressed?

Researchers working with recombinant ZntB commonly encounter several challenges, each requiring specific troubleshooting approaches:

Expression Issues:

  • Problem: Low expression levels
    Solution:

    • Optimize codon usage for expression host

    • Try different promoter systems (T7, tac, araBAD)

    • Test multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3))

    • Consider using low copy number plasmids to reduce metabolic burden

  • Problem: Inclusion body formation
    Solution:

    • Lower induction temperature (16-25°C)

    • Reduce inducer concentration

    • Add solubility enhancers (5-10% glycerol, 1M sorbitol)

    • Co-express with chaperones (GroEL/ES, DnaK/J-GrpE)

    • Use fusion partners (MBP, SUMO, TrxA)

  • Problem: Protein toxicity
    Solution:

    • Use tight promoter control (pLysS strains)

    • Try Lemo21(DE3) for tunable expression

    • Use BL21(DE3):TN7 strain with Gp2 to inhibit host RNAP

Purification Challenges:

  • Problem: Poor solubilization
    Solution:

    • Screen detergents systematically (DDM, LDAO, OG, FC-12)

    • Test different solubilization temperatures and times

    • Add stabilizing agents (glycerol, specific lipids)

  • Problem: Low binding to affinity resins
    Solution:

    • Verify tag accessibility (N vs. C-terminal placement)

    • Optimize binding conditions (buffer, salt, pH)

    • Consider alternative tags if His-tag is inaccessible

  • Problem: Protein instability
    Solution:

    • Add zinc to all buffers (typically 10-50 μM ZnSO₄)

    • Include protease inhibitors

    • Maintain low temperature throughout purification

    • Consider nanodiscs or amphipols for membrane protein stabilization

Functional Assays:

  • Problem: No detectable transport activity
    Solution:

    • Ensure protein is properly folded (circular dichroism)

    • Verify zinc binding capability (ITC, fluorescence)

    • Test reconstitution in different lipid compositions

    • Consider if accessory proteins might be required

  • Problem: High background in transport assays
    Solution:

    • Use transport-deficient strains as backgrounds

    • Include specific inhibitors of other transport systems

    • Design assays to distinguish ZntB-specific activity

For persistent problems, researchers might consider expressing only specific domains of ZntB rather than the full-length protein, particularly for structural studies. Additionally, expressing homologs from thermophilic organisms can sometimes yield more stable proteins for biochemical and structural characterization .

What strategies can resolve data inconsistencies in ZntB functional studies?

When faced with inconsistent data in ZntB functional studies, researchers should employ systematic approaches to identify and resolve discrepancies:

Data Verification Strategies:

  • Replicate experiments independently:

    • Use fresh reagents and cultures

    • Have different researchers perform the experiments

    • Verify equipment calibration

  • Control for environmental variables:

    • Standardize growth media composition (particularly trace metals)

    • Control temperature, pH, and aeration precisely

    • Monitor growth phase carefully

  • Validate reagent quality:

    • Check zinc salt purity and prepare fresh solutions

    • Verify radioisotope specific activity

    • Confirm plasmid sequence integrity

Methodological Troubleshooting:

  • Cross-validate with complementary techniques:

    • If radioisotope assays show inconsistencies, try fluorescent methods

    • Compare growth assays with direct transport measurements

    • Verify protein expression levels by Western blot

  • Systematically vary experimental parameters:

    • Test concentration ranges to identify threshold effects

    • Assess time dependence with more frequent sampling

    • Vary buffer compositions to identify cofactor requirements

  • Address potential interfering factors:

    • Test for metal contamination in media and buffers

    • Consider expression of other transporters under experimental conditions

    • Evaluate membrane integrity during transport assays

Statistical Approaches:

  • Increase statistical power:

    • Perform power analysis to determine adequate sample size

    • Increase number of biological and technical replicates

    • Use statistical methods appropriate for data distribution

  • Identify outliers systematically:

    • Apply formal outlier tests (Grubbs', Dixon's Q)

    • Investigate potential causes for outlying values

    • Document exclusion criteria transparently

  • Consider data transformation:

    • Log-transform highly skewed data

    • Use non-parametric methods when appropriate

    • Apply mixed-effects models to account for batch variation

When inconsistencies persist despite these efforts, consider the possibility that they reflect genuine biological complexity rather than methodological problems. In such cases, formulate new hypotheses that could explain the observed variations, such as condition-dependent regulation, post-translational modifications, or interactions with other cellular components .

What emerging technologies could advance our understanding of ZntB structure and function?

Several cutting-edge technologies offer promising avenues for deeper insights into ZntB biology:

Advanced Structural Biology Approaches:

  • Cryo-electron tomography:

    • Visualize ZntB in native membranes

    • Determine spatial organization and clustering

    • Observe conformational states in situ

  • Single-particle cryo-EM with improved resolution:

    • Capture transport cycle intermediates

    • Resolve zinc binding sites

    • Determine oligomeric states

  • Integrative structural biology:

    • Combine X-ray crystallography, cryo-EM, NMR, and SAXS

    • Create comprehensive structural models

    • Map conformational landscape

Real-Time Single-Molecule Techniques:

  • Single-molecule FRET:

    • Track conformational changes during transport

    • Measure kinetics of individual steps

    • Identify rate-limiting stages

  • High-speed atomic force microscopy:

    • Observe structural dynamics in native-like environments

    • Monitor oligomerization and interactions

    • Visualize responses to zinc concentration changes

  • Nanopore recording:

    • Measure ion conductance through individual ZntB channels

    • Determine selectivity and gating mechanisms

    • Assess effects of mutations on transport properties

Genomic and Systems Biology Approaches:

  • CRISPR-Cas9 screens:

    • Identify genetic interactions with zntB

    • Discover novel components of zinc homeostasis

    • Map suppressor mutations that bypass ZntB function

  • Single-cell multi-omics:

    • Correlate transcription, translation, and zinc content

    • Understand cell-to-cell variability

    • Map ZntB activity to cellular phenotypes

  • Spatial transcriptomics and proteomics:

    • Localize ZntB expression within bacterial communities

    • Identify microenvironmental factors affecting regulation

    • Understand community-level zinc homeostasis

These technologies, particularly when used in combination, could provide unprecedented insights into how ZntB functions at the molecular, cellular, and population levels, potentially revealing new therapeutic targets or biotechnological applications .

How might understanding ZntB transport mechanisms inform development of novel antimicrobial strategies?

The central role of zinc homeostasis in bacterial physiology makes ZntB a potentially valuable target for antimicrobial development:

Therapeutic Targeting Strategies:

  • Direct inhibition approaches:

    • Small molecule inhibitors targeting the transport channel

    • Compounds that interfere with conformational changes

    • Molecules that disrupt oligomerization or membrane insertion

  • Zinc homeostasis disruption:

    • Zinc ionophores to bypass efflux systems

    • Compounds that increase intracellular zinc to toxic levels

    • Zinc mimetics that compete for binding but cannot be transported

  • Regulatory intervention:

    • Molecules that induce zntB downregulation

    • Compounds that prevent stress responses to zinc toxicity

    • Agents that uncouple zinc sensing from transporter expression

Potential Applications:

  • Pathogen-specific targeting:

    • Exploit structural differences between bacterial and human zinc transporters

    • Target regulatory mechanisms unique to bacterial systems

    • Develop strain-specific inhibitors based on ZntB sequence variations

  • Combination therapies:

    • Pair ZntB inhibitors with zinc supplementation

    • Combine with inhibitors of other zinc homeostasis components

    • Synergize with conventional antibiotics that require zinc for activity

  • Anti-virulence approaches:

    • Target zinc-dependent virulence factors

    • Disrupt zinc acquisition during infection

    • Interfere with biofilm formation dependent on zinc homeostasis

To advance these possibilities, researchers should focus on:

  • Detailed structure-function studies to identify druggable sites

  • High-throughput screening for ZntB inhibitors

  • Validation in infection models

  • Assessment of resistance development potential

Understanding the unique structural and functional properties of ZntB, compared to other zinc transporters and human homologs, will be crucial for developing selective antimicrobial agents that disrupt bacterial zinc homeostasis without affecting host cells .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.