Recombinant Escherichia coli O7:K1 Zinc transporter ZupT (zupT)

Shipped with Ice Packs
In Stock

Description

Substrate Specificity and Transport Mechanism

  • Primary Role: ZupT mediates zinc uptake in E. coli under zinc-limiting conditions .

  • Broad Substrate Range: Also transports Fe²⁺, Mn²⁺, and Co²⁺, though with lower affinity compared to Zn²⁺ .

  • Energy Requirement: Functions as a proton-coupled symporter, relying on the chemiosmotic gradient rather than ATP .

Regulation and Expression

  • Constitutive Expression: ZupT is expressed at low basal levels, independent of zinc availability .

  • Genetic Regulation: In E. coli, its transcription is indirectly influenced by Zur (zinc uptake regulator) and ZntR (zinc export regulator) .

Comparative Analysis with Other Transporters

FeatureZupTZnuABC (High-affinity transporter)
Substrate SpecificityZn²⁺, Fe²⁺, Mn²⁺, Co²⁺ Zn²⁺ (exclusive)
AffinityLow (μM range) High (nM range)
Energy CouplingProton gradient ATP-dependent
Role in PathogenesisSecondary role in UPEC virulence Critical for systemic infections

Metal Homeostasis Studies

  • Recombinant ZupT is used to dissect zinc allocation in bacterial cells, particularly under oxidative stress .

  • Key Finding: Salmonella ΔzupT mutants exhibit reduced intracellular free zinc and impaired resistance to hydrogen peroxide .

Pathogenesis and Host Interaction

  • In uropathogenic E. coli (UPEC), ZupT contributes to zinc scavenging in metal-poor environments like host tissues .

  • Mouse Model Data: UPEC ΔzupT strains show no significant colonization defects in bladders but reduced fitness in kidneys during competitive infections .

Biotechnological Tools

  • Recombinant ZupT serves as a control protein in ELISA and metal transport assays .

Key Research Findings

  1. Zinc Homeostasis:

    • ZupT-deficient E. coli strains exhibit growth inhibition in zinc-limited media, reversible by Zn²⁺ supplementation .

    • In Salmonella, dual deletion of znuABC and zupT causes severe zinc starvation and oxidative stress sensitivity .

  2. Regulatory Interplay:

    • ZupT expression compensates for the loss of high-affinity transporters like ZnuABC, highlighting functional redundancy .

  3. Clinical Relevance:

    • UPEC strains lacking ZupT show attenuated kidney colonization in mice, linking zinc uptake to systemic infection .

Future Directions

  • Structural Studies: Cryo-EM analysis of recombinant ZupT could resolve its metal-binding sites and transport mechanism.

  • Therapeutic Targeting: Inhibiting ZupT may reduce bacterial virulence in zinc-scarce host environments .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. This can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development for your product.
Synonyms
zupT; ECIAI39_3536; Zinc transporter ZupT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
zupT
Target Protein Sequence
MSVPLILTILAGAATFIGAFLGVLGQKPSNRLLAFSLGFAAGIMLLISLMEMLPAALAAE GMSPVLGYGMFIFGLLGYFGLDRMLPHAHPQDLMQKSVQPLPKSIKRTAILLTLGISLHN FPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAILWAGISGLA EILGGVLAWLILGSMISPVVMAAIMAVVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCG MSVMGFSLVLLQTAGIG
Uniprot No.

Target Background

Function
Mediates zinc uptake. May also transport other divalent cations.
Database Links
Protein Families
ZIP transporter (TC 2.A.5) family, ZupT subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ZupT and what is its function in E. coli?

ZupT, formerly known as ygiE, is a zinc uptake transporter in Escherichia coli that belongs to the ZIP (ZRT, IRT-like Protein) family of metal ion transporters. It represents the first bacterial member of this transporter family identified, which is otherwise predominantly found in eukaryotes . ZupT is a cytoplasmic membrane protein that facilitates the uptake of zinc ions (Zn²⁺) and potentially other divalent metal cations.

ZupT functions as a constitutively expressed metal ion transporter with a broad substrate range, though it demonstrates a preference for zinc. Unlike the high-affinity ZnuABC zinc transport system, which is regulated by the zinc-responsive transcriptional regulator Zur, ZupT is expressed at relatively constant levels regardless of environmental zinc concentrations .

How does ZupT differ from other zinc transporters in E. coli?

E. coli possesses multiple zinc transport systems that differ in their regulation, mechanism, and affinity:

TransporterFamilyEnergy CouplingRegulationSpecificityAffinity
ZupTZIPChemiosmotic gradientConstitutiveBroad (Zn²⁺, Fe²⁺, Cd²⁺, Cu²⁺)Moderate
ZnuABCABCATP hydrolysisZur-regulated, induced in zinc limitationZn²⁺-specificHigh
ZitBCDFProton antiportZinc-inducibleZinc effluxModerate
ZntAP-type ATPaseATP hydrolysisZntR-regulated, induced by zinc excessHeavy metal efflux (Zn²⁺, Cd²⁺, Pb²⁺)High
PitAPhosphate transporterSecondaryConstitutiveInorganic phosphate (Zn²⁺ as secondary)Low for zinc
MntHNrampProton symportOxyR/Fur-regulatedMn²⁺/Fe²⁺ (Zn²⁺ as secondary)Low for zinc

The ZnuABC system appears to have a higher affinity for zinc than ZupT, as evidenced by greater growth inhibition by EDTA in znuABC deletion mutants compared to zupT deletion mutants . The presence of both high-affinity (ZnuABC) and moderate-affinity (ZupT) zinc import systems allows E. coli to maintain zinc homeostasis across varying environmental zinc concentrations .

What are the established methods for studying ZupT function in E. coli?

Several experimental approaches have been validated for investigating ZupT function:

  • Growth assays with chelators: Growth of wild-type and mutant strains in media containing metal chelators like EDTA can reveal the contribution of ZupT to zinc acquisition. For example, double mutants (ΔznuABC ΔzupT) show greater growth inhibition by EDTA than single mutants or wild-type strains .

  • Radioactive zinc uptake assays: Using ⁶⁵Zn²⁺ to measure zinc uptake in various genetic backgrounds. Studies have shown that cells expressing ZupT from a plasmid exhibit increased uptake of ⁶⁵Zn²⁺ .

  • Metal sensitivity assays: Testing growth on media supplemented with various concentrations of zinc or other metals. Expression of zupT under inducible promoters can lead to zinc hypersensitivity, especially in strains lacking zinc efflux systems (ΔzntA ΔzitB) .

  • Complementation studies: Complementing zupT mutants with plasmid-expressed ZupT to restore wild-type phenotypes .

  • Reporter gene assays: Using zinc-responsive promoters (e.g., PzntA, PznuCB) fused to reporter genes to monitor intracellular zinc status in various genetic backgrounds .

A comprehensive experimental design should include appropriate controls, such as testing the specificity of observed phenotypes by complementation with various metals and comparison with other metal transport mutants.

How can I express and purify recombinant E. coli O7:K1 ZupT protein for structural studies?

For successful expression and purification of recombinant ZupT:

  • Expression system selection:

    • E. coli expression systems are commonly used, with BL21(DE3) or similar strains preferred

    • For membrane proteins like ZupT, consider specialized strains like C43(DE3) designed for membrane protein expression

  • Construct design:

    • The full-length ZupT protein is 257 amino acids

    • N-terminal His-tags facilitate purification while minimizing interference with protein function

  • Expression optimization:

    • Induce expression at lower temperatures (16-20°C) to improve membrane protein folding

    • Use lower inducer concentrations to avoid toxicity (e.g., 0.1-0.2 mM IPTG)

    • Include 0.5-1% glycerol in the growth medium to stabilize membrane proteins

  • Purification strategy:

    • Solubilize membranes using appropriate detergents (n-dodecyl-β-D-maltoside or LDAO are often effective)

    • Purify via immobilized metal affinity chromatography (IMAC)

    • Further purify by size exclusion chromatography

    • For crystallography applications, consider detergent screening to identify conditions promoting crystal formation

  • Quality control:

    • Verify purity by SDS-PAGE (>90% purity is desirable)

    • Confirm identity by Western blotting using anti-His antibodies or ZupT-specific antibodies

    • Assess protein stability by thermal shift assays

The purified protein should be stored in Tris/PBS-based buffer with 6% trehalose, pH 8.0, with addition of 30-50% glycerol for long-term storage at -80°C .

What mutagenesis strategies are most effective for studying ZupT structure-function relationships?

Several targeted approaches can be employed to elucidate structure-function relationships in ZupT:

  • Site-directed mutagenesis:

    • Target conserved histidine and aspartate residues in transmembrane domains, which are likely involved in metal coordination

    • Mutagenize the metal-binding motifs characteristic of ZIP transporters

    • Create alanine scanning mutations across putative transmembrane domains

  • Domain swapping:

    • Exchange domains between ZupT and eukaryotic ZIP transporters to identify regions responsible for metal specificity

    • Create chimeras between ZupT and other bacterial transporters

  • Truncation analysis:

    • Generate N- and C-terminal truncations to identify essential regions for transport activity

    • Express individual transmembrane domains to study their contribution to the transport mechanism

  • Random mutagenesis approaches:

    • Error-prone PCR followed by functional screening

    • Transposon mutagenesis similar to that used in O7-LPS biosynthesis studies

  • CRISPR-Cas9 genome editing:

    • For chromosomal mutations without additional markers

    • Enables precise single nucleotide changes in the native genetic context

A systematic mutagenesis approach combining these strategies has successfully identified key residues in other bacterial transporters and would be applicable to ZupT. When designing mutations, consider using the ZupT sequence alignment with other ZIP family members to target highly conserved residues.

How can I create and validate E. coli deletion mutants for studying ZupT in combination with other zinc transport systems?

Creating deletion mutants requires careful strategy:

  • Sequential deletion construction:

    • Use λ Red recombineering (as described for zupT and znuABC studies)

    • P1 phage transduction for moving mutations between strains

    • Construct a library of single, double, and triple mutants: ΔzupT, ΔznuABC, ΔzntA, ΔzitB, and their combinations

  • Marker selection strategy:

    • Use FRT-flanked resistance cassettes that can be removed by FLP recombinase

    • For multiple deletions, alternate between different antibiotic markers

    • Consider using the "scar-less" deletion approach for removing markers

  • Verification protocol:

    • PCR verification of deletion junctions

    • RT-PCR to confirm absence of transcript

    • Whole genome sequencing to rule out off-target mutations

    • Phenotypic confirmation using growth assays with EDTA and metal supplementation

  • Complementation testing:

    • Express wild-type genes from plasmids with inducible promoters

    • Create plasmid libraries with controlled expression levels using anhydrotetracycline (AHT) induction systems as used in initial ZupT studies

  • Quantitative validation:

    • ⁶⁵Zn²⁺ uptake assays to measure transport activity

    • Growth curves in defined medium with varying zinc concentrations

    • Competition assays between wild-type and mutant strains

The experimental design used by Grass et al. provides an excellent template, where they showed that growth of cells disrupted in both zupT and the znuABC operon was inhibited by EDTA at a much lower concentration than a single mutant or the wild type.

How does ZupT contribute to zinc homeostasis in E. coli under different environmental conditions?

ZupT plays a multifaceted role in zinc homeostasis:

  • Constitutive low-level zinc acquisition:

    • ZupT provides a basal level of zinc uptake activity that is not transcriptionally regulated by zinc availability

    • This ensures minimal zinc uptake even when the high-affinity ZnuABC system is not induced

  • Response to zinc limitation:

    • In zinc-limited environments, ZupT becomes more important for maintaining adequate internal zinc levels

    • The ΔzupT ΔznuABC double mutant shows severe growth defects in zinc-limited media that can be rescued by zinc supplementation

  • Metal buffering capacity:

    • Mathematical modeling of zinc homeostasis in E. coli suggests that ZupT contributes to the cell's ability to buffer against fluctuations in external zinc concentration

    • Data from the dynamic model of zinc homeostasis indicates the presence of an internal zinc reservoir essential for maintaining stable internal zinc concentration

  • Environmental adaptation:

    • The constitutive expression of ZupT allows E. coli to maintain zinc uptake in environments where zinc availability fluctuates unpredictably

    • This complements the stringently regulated ZnuABC system which is only expressed when zinc is scarce

The experimental data from Grass et al. demonstrated that strains lacking ZupT showed increased sensitivity to the zinc chelator EDTA, and expression of ZupT from a plasmid resulted in increased ⁶⁵Zn²⁺ uptake. Further work by Outten and O'Halloran revealed that ZupT contributes to a heterogeneous response to zinc stress within a population, potentially as a bet-hedging strategy for survival in fluctuating environments.

What are the differences in ZupT function between commensal and pathogenic E. coli strains, particularly in the O7:K1 strain?

Comparative analysis reveals important distinctions:

  • Genetic conservation and variation:

    • ZupT is highly conserved across E. coli strains, suggesting fundamental importance

    • The O7:K1 strain (associated with extraintestinal pathogenic E. coli, ExPEC) has a ZupT protein that shares high sequence identity with commensal strains, but may have subtle differences in regulation

  • Role in pathogenesis:

    • Studies with uropathogenic E. coli strain CFT073 showed that ZupT contributes to virulence in the urinary tract infection model

    • The ΔznuABC ΔzupT double mutant showed significantly reduced colonization in bladder and kidney tissues compared to wild-type strains

    • Competition assays revealed that the ΔzupT single mutant had no significant disadvantage during urinary tract infection, while the ΔznuABC mutant showed reduced fitness

  • Virulence factor correlation:

    • Analysis of ExPEC O1:K1:H7/NM isolates, which are related to O7:K1 strains, showed that zinc acquisition systems correlate with other virulence factors

    • 85% of ExPEC B2 and 74% of ExPEC D strains were positive for at least eight virulence genes

  • Functional redundancy in pathogenic strains:

    • Pathogenic strains may have additional zinc acquisition mechanisms that provide redundancy with ZupT

    • In UPEC strain CFT073, ZupT showed less contribution to ⁶⁵Zn²⁺ uptake than in E. coli K-12, suggesting strain-specific differences in its relative importance

  • Host-pathogen interface:

    • In pathogenic strains, ZupT may help overcome "nutritional immunity" where the host restricts zinc availability as a defense mechanism

    • The constitutive expression of ZupT could be advantageous during initial colonization before zinc-responsive systems are fully induced

The comparative analysis by Barkocy-Gallagher et al. of different E. coli strains provides insight into the distribution of virulence factors across pathotypes, which may correlate with metal acquisition systems like ZupT.

What is the metal ion selectivity profile of ZupT, and how can it be experimentally determined?

ZupT demonstrates a broad substrate specificity for divalent metal cations:

  • Known metal substrates:

    • Primary substrate: Zn²⁺

    • Secondary substrates: Fe²⁺, Cd²⁺, Cu²⁺, potentially Mn²⁺

  • Experimental approaches for selectivity determination:

    a) Radioisotope uptake assays:

    • Direct measurement using ⁶⁵Zn²⁺, ⁵⁹Fe²⁺, ⁵⁷Co²⁺ uptake in cells expressing ZupT

    • Competition assays with non-radioactive metals to determine relative affinities

    b) Growth rescue experiments:

    • Testing ability of various metals to rescue growth of metal transport-deficient strains

    • Grass et al. showed that zinc, but not nickel, copper, or cadmium, alleviated EDTA growth inhibition in zupT mutants

    c) Metal sensitivity assays:

    • Expression of ZupT in strains lacking metal efflux systems

    • Measuring growth inhibition upon metal exposure

    • ZupT overexpression made cells hypersensitive to zinc

    d) Biophysical methods:

    • Isothermal titration calorimetry (ITC) with purified ZupT protein

    • Fluorescence spectroscopy using metal-sensitive fluorophores

    • Stability shift assays to measure metal-dependent protein stabilization

  • Quantitative parameters to determine:

    • Affinity constants (Km) for different metals

    • Maximum transport rates (Vmax)

    • Inhibition constants (Ki) for competitive metals

The study by Grass et al. suggested that ZupT is likely a broad-range metal ion transporter based on the observation that Cd(II) antagonized the effect of Zn(II) in a zupT-overexpressing strain, and cells expressing ZupT exhibited a slight increase in Cu(II) sensitivity.

How does ZupT structure relate to its function, and what are the critical amino acid residues involved in metal transport?

While a high-resolution structure of ZupT is not yet available, several structure-function relationships can be inferred:

  • Predicted structural features:

    • ZupT is a 257-amino acid integral membrane protein

    • Contains 8 predicted transmembrane domains characteristic of ZIP family transporters

    • Likely forms a homodimer or higher-order oligomer for function

  • Key functional motifs:

    • Metal binding site likely includes conserved histidine and aspartic acid residues in transmembrane domains

    • The sequence FPEGIATFVTA and FPEGLAVAGPV contains the conserved PEG motif found in many ZIP transporters

    • Residues M41, M44 and M81 likely contribute to a cytoplasmic metal binding site

  • Domain organization:

    • N-terminal extracellular domain (amino acids 1-24)

    • Transmembrane domains connected by variable-length loops

    • Cytoplasmic C-terminal domain may regulate transport activity

  • Functional mechanism implications:

    • ZupT likely utilizes a chemiosmotic gradient rather than ATP hydrolysis for transport

    • The broad substrate specificity suggests a more accessible metal binding site compared to the highly selective ZnuABC system

    • Transport may involve conformational changes similar to those observed in eukaryotic ZIP transporters

  • Comparative insights:

    • As the first identified bacterial ZIP family member, ZupT shares structural features with eukaryotic transporters like Arabidopsis thaliana ZIP1, which can also complement E. coli zinc transport mutants

    • The metal coordination geometry likely determines the preference for zinc over other divalent cations

By analyzing the amino acid sequence of ZupT from Escherichia coli O7:K1 (strain IAI39/ExPEC) in the context of the ZIP family, researchers can identify critical residues for site-directed mutagenesis to validate their role in metal transport.

What is the significance of ZupT in bacterial pathogenesis and host-pathogen interactions?

ZupT plays several important roles in pathogenesis:

  • Contribution to virulence:

    • In UPEC strain CFT073, ZupT and ZnuABC together contribute to fitness during urinary tract infection

    • The ΔznuABC ΔzupT double mutant showed significant reductions in bacterial numbers in both bladder (30-fold) and kidneys (48-fold) compared to wild-type in mouse models

  • Nutritional immunity evasion:

    • Hosts restrict zinc availability as a defense mechanism against pathogens

    • ZupT helps bacteria acquire zinc in zinc-limited host environments

    • Constitutive expression of ZupT may provide an advantage during early infection when inducible systems are not yet fully activated

  • Virulence phenotype mechanisms:

    • Loss of zinc transport systems decreased both motility and resistance to hydrogen peroxide

    • These phenotypes could be restored by supplementation with zinc

    • The reduced resistance to oxidative stress may explain decreased survival in the host

  • Population heterogeneity:

    • Mathematical modeling and experimental data suggest that zinc transport systems contribute to heterogeneous bacterial population responses

    • This heterogeneity may represent a bet-hedging strategy allowing some cells to survive changing zinc conditions during infection

  • Therapeutic targeting potential:

    • As a constitutively expressed transporter, ZupT may be an attractive drug target

    • Inhibiting both ZupT and ZnuABC could significantly impair bacterial zinc acquisition during infection

The study by Sabri et al. demonstrated that complementation of the CFT073 ΔznuABC ΔzupT mutant with the znuACB genes restored growth in zinc-deficient medium and bacterial numbers in infected tissues, confirming the importance of zinc acquisition systems in pathogenesis.

How can quasi-experimental study designs be applied to investigate ZupT function in complex bacterial communities?

Quasi-experimental approaches offer valuable strategies for studying ZupT in complex systems:

  • Interrupted time-series designs:

    • Monitor zinc uptake or bacterial fitness in communities before and after perturbations

    • Example design: O₁ O₂ O₃ O₄ O₅ X O₆ O₇ O₈ O₉ O₁₀ (where X represents introduction of a zinc chelator)

    • This approach can reveal the temporal dynamics of zinc acquisition systems in mixed communities

  • Pretest-posttest designs with control groups:

    • Compare communities with wild-type and ZupT-deficient strains

    • Design notation:

      • Intervention group: O₁ₐ X O₂ₐ

      • Control group: O₁ᵦ O₂ᵦ

    • Allows for assessment of ZupT's contribution while controlling for environmental factors

  • Repeated-treatment designs:

    • Introduce and remove zinc limitation cyclically

    • Design notation: O₁ X O₂ remove-X O₃ X O₄

    • Tests reproducibility of ZupT-dependent responses in complex communities

  • Switching replications design:

    • Apply treatment to one group, then switch to treat the control group

    • Design notation:

      • Intervention group: O₁ₐ X O₂ₐ O₃ₐ

      • Control group: O₁ᵦ O₂ᵦ X O₃ᵦ

    • Particularly useful for studying long-term adaptation to zinc limitation

  • Methodological considerations:

    • Use metagenomic approaches to track population dynamics

    • Employ fluorescent reporters to monitor zinc status in individual cells within communities

    • Combine with spatial sampling to assess niche-specific contributions of ZupT

  • Statistical analysis approaches:

    • Time-series analysis for detecting intervention effects

    • Mixed-effects models to account for nested data structures

    • Bayesian inference for integrating prior knowledge with experimental data

As outlined by Harris et al. , these quasi-experimental designs provide robust frameworks for studying ZupT function in settings where full experimental control is not possible, such as in complex microbial communities or in vivo infection models.

What are the current technical challenges in studying ZupT, and how might they be overcome?

Researchers face several significant challenges:

  • Membrane protein structural determination:

    • Challenge: Obtaining high-resolution structures of membrane proteins like ZupT

    • Solutions:

      • Use of advanced detergents and lipid nanodiscs for stabilization

      • Application of cryo-electron microscopy rather than X-ray crystallography

      • Computational prediction using AlphaFold2 combined with experimental validation

  • Transport kinetics measurement:

    • Challenge: Accurately measuring real-time metal transport in live cells

    • Solutions:

      • Development of genetically-encoded fluorescent zinc sensors with improved sensitivity

      • Application of zinc-selective microelectrodes for continuous monitoring

      • Single-cell microfluidic approaches to track zinc uptake in individual bacteria

  • Functional redundancy:

    • Challenge: Distinguishing ZupT-specific functions from other transporters

    • Solutions:

      • Creation of comprehensive deletion libraries lacking all known and putative zinc transporters

      • Heterologous expression in non-native hosts lacking endogenous zinc transport systems

      • Metal-specific labeling strategies to track the fate of zinc imported via specific transporters

  • Physiological relevance:

    • Challenge: Determining the importance of ZupT under true physiological conditions

    • Solutions:

      • Development of zinc-limited in vivo models that better mimic host environments

      • Application of transposon-sequencing (Tn-seq) to identify conditions where ZupT provides fitness advantages

      • Single-cell tracking of bacterial zinc status during host colonization

  • Regulation understanding:

    • Challenge: Elucidating subtle regulatory mechanisms of the "constitutively expressed" ZupT

    • Solutions:

      • Sensitive promoter-reporter fusions to detect small changes in expression

      • Ribosome profiling to assess translational regulation

      • Protein stability assays to determine post-translational regulatory mechanisms

The methodological advances in membrane protein biochemistry and single-cell analysis techniques offer promising approaches to overcome these challenges.

What are the most promising future research directions for understanding ZupT function in bacterial physiology and pathogenesis?

Several cutting-edge research directions will advance our understanding:

  • Systems biology integration:

    • Develop comprehensive mathematical models of bacterial zinc homeostasis

    • Integrate ZupT function with global metabolic networks and stress responses

    • Apply sensitivity analysis to identify key control points in zinc homeostasis

  • Single-cell heterogeneity:

    • Investigate the stochastic expression of zinc transporters at the single-cell level

    • Test the hypothesis that heterogeneous ZupT expression provides bet-hedging advantages

    • Develop microfluidic platforms to monitor zinc uptake in individual bacteria during stress

  • Host-pathogen interface:

    • Characterize the zinc landscape within host tissues during infection

    • Determine how host nutritional immunity specifically targets zinc transporters

    • Develop strategies to exploit bacterial zinc acquisition as an antimicrobial approach

  • Evolutionary perspectives:

    • Investigate horizontal gene transfer patterns of zinc transporters across bacterial species

    • Compare ZupT sequences and functions across diverse bacterial phyla

    • Determine how zinc transport systems co-evolved with host defense mechanisms

  • Novel therapeutic approaches:

    • Design specific inhibitors of bacterial zinc transport systems

    • Develop zinc-chelating antimicrobial peptides targeted to bacterial infection sites

    • Create probiotic strategies to outcompete pathogens for zinc in host niches

  • Technological innovations:

    • Apply CRISPR interference for precise temporal control of ZupT expression

    • Develop zinc-responsive synthetic biology circuits for bacterial engineering

    • Create zinc-responsive diagnostic biosensors for detecting bacterial infections

The mathematical modeling approach by Outten and O'Halloran demonstrated considerable fluctuations in cellular levels of zinc transport proteins, suggesting that exploring single-cell heterogeneity may be particularly fruitful for understanding ZupT's role in bacterial survival strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.