Recombinant Escherichia coli O8 ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate your preference in the order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery details, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of our products depends on various factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the product for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development for your product.
Synonyms
atpB; ECIAI1_3922; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
atpB
Target Protein Sequence
MASENMTPQDYIGHHLNNLQLDLRTFSLVDPQNPPATFWTINIDSMFFSVVLGLLFLVLF RSVAKKATSGVPGKFQTAIELVIGFVNGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDL LPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMALGVFILILFYSIKMKGIGGFTKELTL QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP WAIFHILIITLQAFIFMVLTIVYLSMASEEH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel, directly involved in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a (atpB) in E. coli?

ATP synthase subunit a (atpB) is a membrane-embedded component of the F₀ complex of the ATP synthase enzyme. In E. coli, it is encoded by the atpB gene (also known as uncB or papD) . The protein consists of 271 amino acids (816 bp) and is primarily located in the inner membrane .

Functionally, subunit a forms part of the proton channel in the F₀ motor complex and is essential for the rotational mechanism that couples proton translocation across the membrane to ATP synthesis in the F₁ catalytic domain. It works in concert with the c-ring (c₁₀ oligomer in E. coli) to facilitate the proton movement that drives the rotary mechanism .

Key structural characteristics:

  • Located in the transmembrane portion of the ATP synthase

  • Contains multiple transmembrane helices

  • Interacts directly with the c-ring subunits

  • Provides the static channel through which protons flow

How does E. coli ATP synthase subunit a differ from equivalent subunits in other organisms?

The E. coli ATP synthase subunit a has some distinct features compared to its counterparts in other organisms:

  • Bacterial vs. Mitochondrial: Unlike mitochondrial ATP synthase, which has additional subunits and regulatory features, E. coli ATP synthase has a simpler subunit composition (ab₂c₁₀α₃β₃γδε) .

  • Homodimeric b subunits: E. coli has a homodimer of b subunits that interacts with subunit a, while other related F-ATP synthases may have heterodimeric arrangements. This creates a unique structural arrangement at the peripheral stalk .

  • C-terminal arrangement: In E. coli, the C-terminus of one of the b subunits (b₂) adopts a unique fold that is not observed in other ATP synthases, forming an additional density peak that can be identified in cryo-EM maps .

  • Regulatory mechanisms: E. coli ATP synthase has specific regulatory mechanisms involving the ε subunit that can adopt different conformations ("up," "half-up," and "down" states) depending on nucleotide binding, which differs from regulatory mechanisms in eukaryotic ATP synthases .

What are the key components of the E. coli ATP synthase complex?

The E. coli ATP synthase complex consists of two main domains: the membrane-embedded F₀ and the catalytic F₁, connected by central and peripheral stalks.

F₀ complex (membrane domain):

  • Subunit a (atpB) - forms proton channel

  • Subunit b (two copies) - forms peripheral stalk

  • Subunit c (forms a ring of 10 subunits) - rotary component

F₁ complex (catalytic domain):

  • α subunits (3 copies)

  • β subunits (3 copies) - contain catalytic sites

  • γ subunit - central rotor shaft

  • δ subunit - connects peripheral stalk to F₁

  • ε subunit - regulatory function

The complete E. coli ATP synthase can be represented as F₁F₀ (α₃β₃γδε-ab₂c₁₀) .

How does the regulatory mechanism of ε subunit affect the function of E. coli ATP synthase?

The ε subunit of E. coli ATP synthase functions as a crucial regulatory component, capable of adopting different conformations that directly impact enzyme activity . Research using cryo-EM has revealed at least three distinct conformational states of the ε C-terminal domain (εCTD):

  • "Up" state: In this inhibitory conformation, the εCTD engages with α, β, and γ subunits, effectively locking the enzyme and preventing functional rotation. This state predominates in the absence of ATP .

  • "Half-up" state: An intermediate conformation observed when the enzyme is exposed to MgATP, where the εCTD is partially detached from the body of the enzyme .

  • "Down" state: A condensed conformation where the εCTD interacts with the N-terminal region of the ε subunit, allowing the enzyme to function actively .

The transition between these states is mediated by ATP binding, which prevents the εCTD from entering the inhibitory "up" state. Cryo-EM studies have shown that after exposure to MgATP, significant conformational changes occur in one of the catalytic β subunits, coupled with the repositioning of the εCTD .

This regulatory mechanism likely prevents wasteful ATP hydrolysis under conditions unfavorable for ATP synthesis, providing a physiological advantage to E. coli under varying energy conditions.

What role does cardiolipin play in E. coli ATP synthase function?

Cardiolipin (CL) plays a critical role in modulating the activity of E. coli ATP synthase through specific lipid-protein interactions. Research has demonstrated:

  • Activity dependence on CL: The ATPase activity of F₁F₀ is significantly affected by the presence of cardiolipin in the membrane. When reconstituted in proteoliposomes lacking CL, the enzyme shows substantially different activity patterns compared to those containing CL .

  • Interaction sites: Cardiolipin interacts with the cytoplasmic face of the peripheral stalk that connects the catalytic F₁ domain to the F₀ domain. These interactions help stabilize the stator and maintain proper structural alignment .

  • Modulation by antimicrobial peptides: The antimicrobial peptide EcDBS1R4 can modulate ATP synthase activity through sequestration of cardiolipin. This demonstrates how membrane lipid reorganization can affect protein function without direct protein binding .

Experimental evidence shows that ATP synthase activity was inhibited by ~20% in inner membrane vesicles when exposed to EcDBS1R4. Similar inhibition occurred in POPC:POPG:CL (60:35:5) proteoliposomes, while pure POPC proteoliposomes without CL showed no significant activity change .

These findings highlight how lipid composition and organization in the membrane environment are critical factors in ATP synthase function, beyond just the protein components themselves.

What methods are used to investigate the rotary mechanism of E. coli ATP synthase?

Researching the rotary mechanism of E. coli ATP synthase employs several sophisticated techniques:

  • Cryo-electron microscopy (cryo-EM): This technique has been instrumental in capturing different conformational states of ATP synthase. By freezing samples after addition of MgATP, researchers have visualized transitions between states, particularly in the ε subunit and catalytic β subunits . Recent advances have achieved sufficient resolution to reveal details of the rotary mechanism.

  • Cross-linking studies: The c-ring stoichiometry has been investigated using intermolecular cross-linking via oxidation of bi-cysteine-substituted subunit c. This approach has shown that E. coli consistently maintains a c₁₀ ring structure regardless of growth conditions or the presence of other F₀F₁ subunits .

  • Fusion protein studies: Research has demonstrated that it's possible to generate functional E. coli ATP synthase containing a b/δ fusion protein, providing insights into the roles of individual b subunits in the stator stalk .

  • Molecular dynamics simulations: These computational approaches have been used to model the interactions between ATP synthase components and the surrounding lipid environment, providing insights into how membrane composition affects enzyme function .

  • Site-directed mutagenesis: Creating specific mutations in ATP synthase subunits has helped identify critical residues involved in proton translocation, subunit interactions, and catalytic activity.

How can recombinant E. coli ATP synthase subunit a be efficiently expressed and purified?

Recombinant expression and purification of E. coli ATP synthase subunit a (atpB) requires specialized approaches due to its hydrophobic nature and membrane localization:

Expression System:

  • Vector selection: For high-level expression, pZ-ASS vectors with strong constitutive promoters (such as pgi #20) have proven effective for expressing ATP synthase components .

  • E. coli strain selection: BL21(DE3) strains are often preferred due to their higher yields of cell dry mass and growth rate compared to K-12 strains such as RV308 and HMS174 . The B strain also accumulates less acetate, which is beneficial for protein expression.

  • Growth conditions: M9 minimal medium supplemented with trace elements is commonly used for controlled expression. For optimal growth, the medium can be supplemented with:

    • 47.8 mM Na₂HPO₄

    • 22 mM KH₂PO₄

    • 8.6 mM NaCl

    • 18.7 mM NH₄Cl

    • 2 mM MgSO₄

    • 100 μM CaCl₂

    • Trace elements (134 μM EDTA, 31 μM FeCl₃·6H₂O, etc.)

Purification Protocol:

  • Cell lysis using high-pressure homogenization in buffer containing detergents suitable for membrane proteins (e.g., n-dodecyl-β-D-maltoside)

  • Membrane fractionation via differential centrifugation

  • Solubilization of membrane proteins with appropriate detergents

  • Affinity chromatography using N-terminal 6xHis-tag

  • Size exclusion chromatography for final purification

This approach yields purified recombinant atpB that can be used for structural and functional studies.

What methods are used to reconstitute functional ATP synthase in proteoliposomes?

Reconstitution of functional E. coli ATP synthase in proteoliposomes is a critical method for studying its activity in a controlled membrane environment:

Proteoliposome Preparation Protocol:

  • Lipid preparation:

    • Common compositions include:

      • POPC:POPG:CL (60:35:5) - mimics bacterial membrane

      • DOPE:POPG:CL (65:30:5) - alternative composition with curvature effects

      • Pure POPC - control without cardiolipin

    • Lipids are dissolved in chloroform, dried under nitrogen, and rehydrated in buffer

  • Protein incorporation:

    • Detergent-mediated reconstitution: Purified ATP synthase is added to detergent-destabilized liposomes

    • Detergent removal: Achieved through dialysis or adsorption onto Bio-Beads

    • Final protein-to-lipid ratio: Typically 1:50 to 1:100 (w/w)

  • Quality control:

    • Size homogeneity assessment using dynamic light scattering

    • Protein orientation verification using accessibility assays

    • Proton impermeability check using pH-sensitive dyes

Activity Assays for Reconstituted ATP Synthase:

  • ATP hydrolysis (ATPase activity):

    • Measured using the malachite green assay to detect released phosphate

    • Standard conditions: 2-5 μg protein, 50 mM Tris-HCl (pH 8.0), 3 mM MgCl₂, 10 mM ATP

  • ATP synthesis:

    • Induced by creating a proton gradient (ΔpH and Δψ)

    • Gradient generation methods:

      • Acid-base transition

      • K⁺/valinomycin system

    • ATP detection via luciferase-based luminescence assays

  • Proton pumping:

    • Monitored using pH-sensitive fluorescent dyes (ACMA or pyranine)

    • Indicates coupled activity of the F₀ and F₁ domains

How can researchers study conformational changes in ATP synthase using cryo-EM?

Cryo-electron microscopy (cryo-EM) has emerged as a powerful technique to study conformational changes in E. coli ATP synthase, particularly for capturing different functional states:

Sample Preparation Protocol:

  • Protein preparation:

    • Purify E. coli ATP synthase to high homogeneity (>95%)

    • Final concentration: 2-5 mg/ml in buffer containing:

      • 20 mM Tris-HCl pH 7.4

      • 150 mM NaCl

      • 2 mM MgCl₂

      • 0.05% digitonin or other suitable detergent

  • Nucleotide incubation:

    • For capturing active states: Incubate with 10 mM MgATP for specific time periods before freezing

    • For inhibited states: Prepare samples without exogenous nucleotide addition

  • Cryo-freezing:

    • Apply 3-4 μl sample to glow-discharged holey carbon grids

    • Blot for 2-4 seconds

    • Plunge-freeze in liquid ethane using an automated plunger (Vitrobot or similar)

Data Collection and Analysis:

  • Imaging parameters:

    • Electron microscope: 300 kV with direct electron detector

    • Dose: 40-60 e⁻/Ų total, fractioned across multiple frames

    • Magnification: To achieve 1-1.5 Å/pixel sampling

  • Image processing workflow:

    • Motion correction and dose weighting

    • CTF estimation and correction

    • Particle picking (automatic and manual)

    • 2D classification to remove ice contamination and damaged particles

    • 3D classification to separate different conformational states

    • 3D refinement for high-resolution reconstruction

    • Model building and refinement

  • Conformational analysis:

    • Focus on specific domains (e.g., εCTD positions, β subunit conformations)

    • Compare structures with and without ATP to identify regulatory mechanisms

    • Map nucleotide binding sites and occupancy

Using this approach, researchers have successfully identified multiple conformational states of E. coli ATP synthase, including the "up," "half-up," and "down" positions of the ε subunit that correspond to different functional states .

How can ATP synthase subunit a mutations be used to study proton translocation mechanisms?

Site-directed mutagenesis of ATP synthase subunit a (atpB) has been instrumental in understanding the proton translocation mechanism in E. coli:

Key Residues for Mutagenesis Studies:

  • Arginine 210 (R210): This highly conserved residue in subunit a is critical for proton translocation. Mutations at this position typically result in complete loss of function, as it forms part of the proton path at the a-c subunit interface.

  • Aspartic acid 61 (D61) of subunit c: Although not in subunit a, this residue in subunit c interacts with subunit a during proton translocation. The successive protonation/deprotonation of this carboxylate group drives the rotation of the c-ring relative to subunit a .

  • Transmembrane helices: Mutations in the transmembrane helices of subunit a that face the c-ring can alter proton access or the interaction between subunits.

Experimental Approach:

  • Site-directed mutagenesis: Generate specific mutations in the atpB gene using PCR-based methods.

  • Complementation assays: Transform the mutated atpB gene into E. coli strains lacking functional ATP synthase and assess growth on non-fermentable carbon sources.

  • ATP synthesis/hydrolysis assays: Measure enzymatic activity of purified mutant enzymes or membrane vesicles containing mutant ATP synthase.

  • Proton pumping assays: Use pH-sensitive fluorescent dyes to measure proton translocation activity of reconstituted mutant enzymes.

  • Structural studies: Combine functional data with structural information from cryo-EM to correlate structural changes with functional effects.

This integrated approach has helped establish the current model of proton translocation, where subunit a provides a pathway for protons to access the critical Asp61 residue in the c-ring, driving rotation through sequential protonation events.

How does the stoichiometry of subunit c in the E. coli ATP synthase c-ring affect bioenergetics?

The c-ring stoichiometry is a critical determinant of ATP synthase bioenergetics, as it defines the H⁺/ATP ratio:

C-ring Stoichiometry in E. coli:

Research has definitively established that E. coli maintains a constant c₁₀ ring stoichiometry regardless of growth conditions. This was determined through intermolecular cross-linking studies of bi-cysteine-substituted subunit c (cA21C/cM65C), which consistently showed cross-link formation stopping at the formation of decamers .

Bioenergetic Implications:

  • H⁺/ATP ratio: With 10 c subunits and 3 catalytic sites in F₁, E. coli ATP synthase requires ~3.33 protons to synthesize 1 ATP molecule. This ratio defines the bioenergetic efficiency of the enzyme.

  • Energy threshold: The c₁₀ stoichiometry sets the minimum proton motive force (PMF) required for ATP synthesis. A larger c-ring would reduce this threshold but decrease efficiency at high PMF.

  • Evolutionary adaptation: The constant c₁₀ stoichiometry in E. coli, regardless of carbon source or metabolic status, suggests this is an optimized configuration for its ecological niche .

Experimental Evidence:

To investigate c-ring dependence on metabolic status, cells of E. coli atp deletion strain DK8 transformed with plasmid pBWU13.NOC (which synthesizes ATP synthase with bi-cysteine-substituted subunit c) were grown on various carbon sources:

  • Luria-Bertani rich medium

  • Minimal medium with glucose

  • Minimal medium with glycerol

  • Minimal medium with succinate

In all cases, the same pattern of cross-link formation was observed, indicating a consistent c₁₀ ring structure regardless of growth condition .

What is the role of the peripheral stalk in coupling F₁ and F₀ domains in E. coli ATP synthase?

The peripheral stalk in E. coli ATP synthase plays a crucial role in coupling the F₁ and F₀ domains and maintaining efficient energy conversion:

Structure and Composition:

The peripheral stalk in E. coli consists of:

  • Two identical b subunits (forming a homodimer)

  • The δ subunit

  • Interactions with the N-terminal regions of α subunits

Cryo-EM studies have revealed that the two b subunits extend approximately 233 Å (b₁) and 227 Å (b₂) from the membrane, with the b₂ subunit having a unique C-terminal fold not observed in other ATP synthases .

Functional Roles:

  • Stator function: The primary role is to prevent the F₁ sector from rotating with the central stalk during catalysis, serving as a stationary frame against which rotation can occur.

  • Flexibility coupling: Research using fusion proteins has shown that the full-length b subunit (which can be covalently linked to δ) is responsible for connecting the stalk to the catalytic F₁ subcomplex, while its transmembrane helix is not required for this function .

  • F₀ anchoring: The second b subunit (which can be shortened to a b' type) has a primary role in attachment to the F₀ complex and only a minor role in binding to δ .

  • Lipid interactions: The peripheral stalk interacts with cardiolipin at the cytoplasmic face, which helps maintain proper structural alignment. Disruption of these interactions can impair ATP synthase function .

Experimental Evidence:

Studies using b/δ fusion proteins have demonstrated that it is possible to generate a functional E. coli ATP synthase with such constructs, allowing detailed analysis of the individual roles of the b subunits. This work showed that the b subunit can be functionally divided into domains with specific roles in connecting F₁ and F₀, providing insight into the evolutionary adaptation of the stator stalk .

What are the emerging approaches for studying ATP synthase in native membrane environments?

Several cutting-edge approaches are being developed to study ATP synthase function in more native contexts:

  • Nanodiscs and native nanodiscs: These provide a defined lipid bilayer environment for membrane proteins. By incorporating E. coli ATP synthase into nanodiscs with controlled lipid composition, researchers can study how specific lipids (like cardiolipin) affect function while maintaining a native-like membrane environment.

  • In-cell cryo-electron tomography: This emerging technique allows visualization of macromolecular complexes within their cellular context. Applying this to thin regions of E. coli cells could potentially reveal the native organization and interactions of ATP synthase in situ.

  • Single-molecule FRET: By strategically placing fluorescent probes on different subunits of ATP synthase, researchers can monitor conformational changes and rotational dynamics in real-time at the single-molecule level, providing insights into the kinetics and mechanics of the enzyme.

  • Optogenetic approaches: Development of light-sensitive proton pumps could allow controlled generation of proton gradients to study ATP synthase under precisely controlled energetic conditions.

  • Advanced computational methods: Combining structural data with molecular dynamics simulations that include explicit membrane environments can provide atomic-level insights into how ATP synthase functions within the lipid bilayer.

These approaches promise to bridge the gap between highly controlled but artificial experimental systems and the complex native environment of ATP synthase, potentially revealing new regulatory mechanisms and interactions.

How might ATP synthase research contribute to antimicrobial development?

E. coli ATP synthase research has significant implications for antimicrobial development:

  • Exploiting structural differences: The structural differences between bacterial and human ATP synthases can be leveraged to develop selective inhibitors. For example, the unique arrangements of peripheral stalks in E. coli and the specific interactions with cardiolipin present potential targets .

  • Membrane-mediated inhibition: The discovery that antimicrobial peptides like EcDBS1R4 can modulate ATP synthase activity by sequestering cardiolipin represents a novel mechanism of action. This lipid reorganization approach could inspire new classes of antimicrobials that don't directly bind protein targets but disrupt their lipid environment .

  • Regulatory mechanisms: The distinct regulatory mechanisms involving the ε subunit in bacterial ATP synthases provide another potential target. Compounds that lock the ε subunit in its inhibitory "up" state could selectively inhibit bacterial ATP synthesis .

  • Combined targeting approaches: ATP synthase inhibition could be particularly effective when combined with other antimicrobials that compromise bacterial energy metabolism, creating synergistic effects that reduce the likelihood of resistance development.

This research area is particularly promising given the essential nature of ATP synthase and the increasing problem of antimicrobial resistance, driving the need for novel drug targets with unique mechanisms of action.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.