Recombinant Escherichia coli O8 Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Function and Mechanism

Cls catalyzes the formation of cardiolipin from two molecules of phosphatidylglycerol (PG) . The reaction involves the transfer of a phosphatidyl group from one PG molecule to another, resulting in the formation of CL and glycerol .

The basic reaction is:

2 Phosphatidylglycerol → Cardiolipin + Glycerol

Cls shares homology with phospholipase D, suggesting that the active site comprises functional groups from both PLD1 and PLD2 domains, with histidine (His217) acting as the potential active-site nucleophile .

Structure and Properties

The E. coli Cls has a molecular weight of approximately 46 kDa as determined by SDS-PAGE . The enzyme can be purified using techniques such as extraction with Triton X-114 and chromatography on DEAE-cellulose . The enzyme's activity is influenced by temperature, with an optimal temperature of 37°C, and it remains stable for up to 1 hour at 45°C but loses activity rapidly at 55°C .

Role in Bacterial Physiology

Cardiolipin plays a crucial role in various bacterial physiological processes:

  • Biofilm Formation: CL influences biofilm formation in E. coli . Depletion of CL can reduce biofilm formation by as much as 50% . The absence of cardiolipin activates the Rcs envelope stress response, which represses the production of flagella and disrupts initial biofilm attachment, thus reducing biofilm growth .

  • Protein Translocation: CL is important for the translocation of proteins across the inner membrane . Reduction in CL concentration impairs protein translocation, potentially activating the Rcs pathway through the outer membrane lipoprotein RcsF .

  • Stress Response: Expression of cls increases under osmotic stress and as E. coli enters the stationary phase in low osmolality medium .

  • Regulation of Two-Component Systems: Cardiolipin is critical for sustaining the full activity of SaeRS and other TCSs in Staphylococcus aureus .

Biochemical Characterization of Cls Mutations

Mutations in Cls can impact its activity and affect bacterial adaptation to stress. For example, mutations associated with adaptation to daptomycin (DAP) increase Cls activity . Studies have characterized Cls enzymes from Enterococcus faecium and Enterococcus faecalis, including variants with single-amino-acid changes derived from DAP-resistant isolates .

ParameterE. faecium Cls447aE. faecium Cls447a H215RE. faecium Cls447a R218Q
Vmax (µM CL/min/µM protein)0.16 ± 0.010.26 ± 0.020.26 ± 0.04

These mutations are often located near the phospholipase domain 1 (PLD1) active site .

Inhibition and Regulation

Cls activity is regulated by various factors:

  • Product Inhibition: Cls is inhibited by its product, cardiolipin .

  • Phospholipids: Phosphatidate inhibits Cls, while phosphatidylethanolamine can partially offset the inhibition by cardiolipin .

  • Metal Ions: Metal ions like Mg2+, Co2+, and Cd2+ do not significantly affect enzyme activity .

  • Inhibitors: FOS-12 can inhibit Cls activity, likely acting as a competitive inhibitor due to its similarity to phosphatidylglycerol (PG) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag type, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; ECIAI1_1268; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
clsA
Target Protein Sequence
MTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCERRQGIAGVKGNQ LQLMTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLAIDDKGFGADLAAVQDDYISRSRLLDARLWLKRPLWQRVAERLFY FFSPLL
Uniprot No.

Target Background

Function

Function: Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.

Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is cardiolipin synthase and what is its role in E. coli?

Cardiolipin synthase (CLS) is an enzyme responsible for synthesizing cardiolipin, a dimeric phospholipid essential for bacterial membrane structure and function. In E. coli, the CLS enzyme is encoded by the cls gene and has a molecular weight of approximately 46,000 Da . Cardiolipin plays crucial roles in maintaining membrane integrity, supporting respiratory chain complexes, and contributing to cell division processes.

The physiological significance of cardiolipin is demonstrated by the observation that cls mutation alone results in a measurable decrease in growth rate . This indicates that cardiolipin contributes to optimal cellular function even under standard growth conditions. Moreover, the growth defects become more pronounced when cls mutations are combined with other phospholipid biosynthesis mutations, highlighting cardiolipin's role in membrane homeostasis.

What is the genetic organization of the cls gene in E. coli O8?

The cls gene itself has been mapped to approximately 27 minutes on the E. coli chromosome . It is genetically distinct from the chlC gene, as demonstrated by the fact that transformation with a plasmid containing cls did not complement chlorate resistance in chlC mutants . The complete functional cls gene can be contained within a 1.9-kb DNA fragment, which is sufficient for complementation of cls mutations and expression of active cardiolipin synthase .

How does the molecular structure of cardiolipin synthase relate to its enzymatic function?

Cardiolipin synthase is a membrane-associated enzyme that catalyzes the condensation of two phosphatidylglycerol molecules to form cardiolipin. The protein has been identified as having a molecular weight of 46,000 Da through maxicell analysis and sodium dodecyl sulfate-polyacrylamide gel electrophoresis . This molecular weight is consistent with the protein being encoded by an open reading frame found in the middle of the 1.9-kb fragment that contains the cls gene .

The enzyme's function appears to be regulated not just by its expression level but also by its interaction with the membrane environment. This is evidenced by the observation that amplification of cardiolipin synthase activity was not proportional to gene dosage, with enzyme activity reaching at most 10 times that in wild-type cells despite much higher gene copy numbers . This suggests complex post-transcriptional or post-translational regulatory mechanisms affecting enzyme activity, potentially including feedback inhibition, substrate availability limitations, or membrane integration constraints.

What are the optimal vectors and strategies for cloning the cls gene from E. coli O8?

The choice of vector for cloning the cls gene depends significantly on research objectives and experimental constraints. Based on published research, both low-copy-number and high-copy-number vectors have been successfully used, each with distinct advantages:

Table 1: Vector Options for cls Gene Cloning

Vector TypeExamplesAdvantagesLimitationsBest Applications
Low-copy-numberpML31 (mini-F vector)Minimizes toxicity effects; Suitable for complementation studiesLower protein yieldInitial cloning; Work with pss mutant strains
High-copy-numberpBR322Higher expression levels; Better for protein productionGrowth inhibition in pss-1 mutantsProtein purification; Expression in wild-type strains

The cls gene was initially cloned in a 5-kilobase-pair DNA fragment inserted in the mini-F vector pML31, and subsequently subcloned into a 2.0-kilobase-pair fragment inserted in pBR322 . This progression from low-copy to high-copy vectors represents a logical strategy for maximizing expression while managing potential growth effects.

For optimal cloning outcomes, researchers should consider:

  • The genetic background of the host strain, particularly regarding phospholipid metabolism

  • The intended application (complementation studies versus protein production)

  • The need for regulated expression (constitutive versus inducible systems)

How does vector copy number affect the expression and activity of recombinant cardiolipin synthase?

The relationship between gene copy number and cardiolipin synthase expression exhibits complex non-linear dynamics, revealing sophisticated regulatory mechanisms governing phospholipid metabolism:

This discrepancy between gene dosage, enzyme activity, and product accumulation suggests multiple regulatory checkpoints:

  • Transcriptional/translational regulation limiting enzyme production

  • Post-translational mechanisms controlling enzyme activity

  • Metabolic feedback inhibition limiting cardiolipin accumulation

  • Physical constraints on membrane composition

These observations highlight important considerations for experimental design when expressing recombinant cardiolipin synthase. Simply increasing gene copy number will not proportionally increase cardiolipin production, as cellular regulatory mechanisms actively maintain membrane phospholipid homeostasis.

What selection strategies are effective for identifying cls+ clones in various genetic backgrounds?

Effective selection of recombinant cls+ clones requires strategic approaches that leverage the physiological consequences of cardiolipin synthesis. Based on published methodologies, the following selection strategies have proven effective:

The most powerful selection system exploits synthetic genetic interactions between cls and other phospholipid biosynthesis genes. Specifically, a cls pss-1 double mutant exhibits severe growth defects at 42°C in NBY medium supplemented with 200 mM sucrose (NBY-S200) . Introduction of a functional cls gene complements this growth defect, providing a clear positive selection for cls+ transformants.

This genetic background-based selection was crucial for the initial cloning of the cls gene, as attempts to clone directly into high-copy-number vectors under these selective conditions were unsuccessful due to growth inhibition . The successful strategy involved:

  • Initial transformation into a cls pss-1 double mutant

  • Selection for growth at 42°C in NBY-S200 medium

  • Identification of transformants carrying the cls gene in a low-copy-number vector

  • Subsequent subcloning into higher-copy vectors for enhanced expression

For researchers working with different genetic backgrounds, alternative screening approaches include:

  • Direct phenotypic screening: Analyzing transformants for cardiolipin content using lipid extraction and thin-layer chromatography

  • Enzyme activity assays: Measuring cardiolipin synthase activity in membrane preparations

  • Molecular confirmation: PCR or hybridization using cls-specific probes

How can experimental design approaches optimize expression of functional recombinant cardiolipin synthase?

Optimizing expression of functional recombinant cardiolipin synthase requires systematic consideration of multiple variables affecting protein production and activity. While specific optimization parameters for cardiolipin synthase aren't detailed in the available literature, principles from experimental design approaches in recombinant protein expression can be applied .

A structured experimental design methodology should address the following key factors:

Table 2: Experimental Design Parameters for Optimizing Recombinant CLS Expression

ParameterVariables to ConsiderMonitoring MethodsOptimization Goal
Expression vectorPromoter strength, copy number, fusion tagsSDS-PAGE, Western blotBalance expression level with toxicity
Host strainWild-type vs. cls mutant, pss+ vs. pss-Growth curves, viabilityMaximize viability with desired expression
Growth temperature25-37°C rangeEnzyme activity, solubilityBalance growth rate with proper folding
Media compositionRich vs. minimal, supplementsMembrane isolation yieldSupport robust membrane development
Induction parametersInducer concentration, timing, durationTime-course activity assaysOptimize active enzyme production

The systematic variation of these parameters using factorial design approaches would allow identification of optimal conditions for producing functional cardiolipin synthase . Given the enzyme's membrane association, particular attention should be paid to extraction methods using suitable detergents for activity assays or purification.

Performance should be assessed based on multiple criteria:

  • Total enzyme activity in membrane preparations

  • In vivo cardiolipin levels

  • Growth characteristics of the expression strain

  • Protein stability and purification yield if applicable

What methodological approaches are available for measuring cardiolipin synthase activity?

Comprehensive assessment of cardiolipin synthase activity requires complementary in vitro and in vivo approaches that together provide insights into enzyme function and physiological consequences:

In vitro enzyme activity assays:
While detailed protocols aren't provided in the available literature, cardiolipin synthase activity has been successfully measured in membrane preparations from various E. coli strains . Standard enzymological approaches would involve:

  • Isolation of membrane fractions from cells expressing recombinant cardiolipin synthase

  • Incubation with phosphatidylglycerol substrate under appropriate buffer conditions

  • Extraction of lipids and quantification of cardiolipin production

  • Calculation of specific activity based on protein content

In vivo cardiolipin content analysis:
To assess the functional outcome of cardiolipin synthase activity, cellular phospholipid composition can be analyzed:

  • Extraction of total cellular lipids using chloroform/methanol or similar methods

  • Separation by thin-layer chromatography to resolve cardiolipin from other phospholipids

  • Visualization and quantification through phosphorus assay or staining methods

Complementation assays:
Functional cardiolipin synthase activity can also be assessed through genetic complementation:

  • Introduction of cls constructs into cls mutant strains

  • Evaluation of growth restoration, particularly under conditions where cardiolipin is important (e.g., in a pss-1 background at elevated temperatures)

  • Correlation of growth phenotypes with enzyme activity levels

For comprehensive characterization, researchers should combine these approaches to establish relationships between enzyme expression, activity, and physiological outcomes.

How does cls gene mutation affect E. coli growth and membrane properties?

The phenotypic consequences of cls mutation reveal fundamental roles for cardiolipin in bacterial physiology, with effects that vary depending on genetic background and environmental conditions:

In isolation, cls mutation causes a small but significant decrease in growth rate under standard laboratory conditions . This indicates that while cardiolipin is not absolutely essential for viability in E. coli, it contributes to optimal growth and cellular function.

The physiological importance of cardiolipin becomes more apparent in certain genetic backgrounds. Particularly notable is the synthetic interaction with phosphatidylserine synthase mutations. In cells harboring the pss-1 allele (a temperature-sensitive mutation affecting phosphatidylserine synthase), the cls mutation causes a severe growth defect and increased temperature sensitivity . This suggests that cardiolipin and phosphatidylserine may have partially overlapping functions in maintaining membrane integrity.

The growth defects in cls pss-1 double mutants are not remediable with supplements like sucrose or MgCl₂, which can partially rescue pss-1 single mutants . This indicates that cardiolipin plays specific roles in membrane function that cannot be compensated by osmoprotectants or membrane-stabilizing agents.

These observations collectively point to important roles for cardiolipin in:

  • Maintaining optimal membrane physical properties

  • Supporting respiratory functions

  • Facilitating stress responses

  • Providing functional redundancy with other phospholipids

What regulatory mechanisms govern the relationship between cardiolipin synthase activity and membrane cardiolipin levels?

A striking finding from studies of recombinant cardiolipin synthase is the non-linear relationship between enzyme activity and actual cardiolipin accumulation in bacterial membranes:

Despite amplification of cardiolipin synthase activity to levels up to 10 times that in wild-type cells (when expressed from high-copy-number plasmids), the cardiolipin content in vivo increased to a maximum of only 1.5 times that in wild-type strains . This dramatic discrepancy reveals sophisticated regulatory mechanisms governing membrane phospholipid composition.

Several potential regulatory mechanisms could explain this observation:

This tight regulation suggests that membrane phospholipid composition is a highly regulated parameter, and that maintaining specific phospholipid ratios is critical for proper membrane function. This has important implications for biotechnological applications seeking to modify membrane composition through genetic engineering.

How do synthetic genetic interactions between cls and other phospholipid biosynthesis genes inform our understanding of membrane homeostasis?

The interaction between cls mutations and other phospholipid biosynthesis defects provides valuable insights into the principles governing bacterial membrane homeostasis:

The most extensively characterized synthetic interaction involves cls and pss mutations. In cells harboring the pss-1 allele (a temperature-sensitive mutation for phosphatidylserine synthase), cls mutation causes a severe growth defect and increased temperature sensitivity . This indicates that cardiolipin and phosphatidylserine contribute to membrane function in ways that are partially redundant.

This synthetic interaction has several noteworthy features:

  • The growth defect of pss-1 cls double mutants is more severe than would be predicted from the individual mutations, indicating synergistic rather than merely additive effects.

  • While pss-1 single mutants can be partially rescued by supplements like sucrose or MgCl₂, these supplements do not remedy the defects in pss-1 cls double mutants .

  • High-copy-number plasmids containing the cls gene inhibit the growth of pss-1 mutants under selective conditions (42°C in NBY-S200), but not at lower temperatures (30°C) or in pss+ strains .

These observations reveal principles of membrane homeostasis:

  • Distinct phospholipids can compensate for each other's functions to some extent.

  • The balance between different phospholipid species is critical for membrane integrity.

  • Both insufficient and excessive levels of specific phospholipids can compromise membrane function.

  • Temperature sensitivity often reveals latent defects in membrane composition.

These principles are valuable for understanding bacterial adaptation to environmental stresses and for designing strategies to manipulate membrane composition for research or biotechnological applications.

How can recombinant cardiolipin synthase be used to engineer bacterial membranes with specific properties?

Recombinant cardiolipin synthase offers a potential tool for engineering bacterial membranes with modified properties, though with important constraints imposed by cellular regulatory mechanisms:

Strategies for membrane engineering using recombinant CLS:

Potential applications:

  • Enhanced stress tolerance in industrial strains

  • Improved hosts for membrane protein production

  • Altered permeability characteristics for biotechnological applications

  • Model systems for studying membrane protein function

When designing such applications, researchers must account for the regulatory constraints on phospholipid composition and the potential growth effects of perturbing membrane homeostasis.

What insights does cls gene manipulation provide into bacterial stress response mechanisms?

Manipulation of the cls gene provides a valuable experimental approach for understanding how membrane phospholipid composition influences bacterial stress responses:

Temperature stress responses appear to involve cardiolipin, as evidenced by the increased temperature sensitivity of cls mutants, particularly in a pss-1 background . This suggests that cardiolipin contributes to membrane stability or function at elevated temperatures. Controlled expression of recombinant cardiolipin synthase could help elucidate the specific mechanisms by which cardiolipin supports temperature adaptation.

Osmotic stress tolerance may also involve cardiolipin. The selection conditions used for identifying cls+ clones included high sucrose concentrations (200 mM) , suggesting a potential role for cardiolipin in osmotic stress responses. Systematic studies varying cardiolipin levels and osmotic conditions could clarify this relationship.

The interaction between membrane composition and other stress responses (oxidative, pH, antibiotic) remains to be fully explored, but the established methodology for cls gene manipulation provides tools for such investigations. By combining controlled cls expression with various stress conditions and global transcriptomic or proteomic analyses, researchers could map the regulatory networks connecting membrane composition to stress adaptation.

The observed tight regulation of membrane cardiolipin levels despite increased enzyme activity suggests that maintaining specific phospholipid compositions is itself an important aspect of stress response regulation. Understanding the mechanisms underlying this regulation could reveal new principles of bacterial adaptation.

How can cls gene expression systems contribute to studies of bacterial pathogenesis and antibiotic resistance?

While the available literature doesn't directly address the relationship between cardiolipin synthesis and bacterial pathogenesis or antibiotic resistance, several potential research directions emerge:

Pathogenesis applications:

E. coli O8 strains have been implicated in human infections, with O8:H8 strains specifically identified in diarrheal outbreaks . These pathogens carry virulence factors like heat-labile enterotoxins , but their membrane composition may also influence virulence properties. Systems for manipulating cls expression could help elucidate:

  • How cardiolipin levels affect adherence to host cells

  • The role of membrane composition in environmental persistence

  • The impact of membrane properties on toxin secretion

  • The relationship between phospholipid composition and immune evasion

Antibiotic resistance studies:

Membrane composition is known to influence bacterial susceptibility to antimicrobial agents, particularly those targeting membrane integrity. Recombinant cardiolipin synthase expression systems could enable:

  • Systematic analysis of how cardiolipin levels correlate with susceptibility to membrane-active antibiotics

  • Investigation of membrane adaptation mechanisms during antibiotic exposure

  • Development of membrane-targeting combination therapies that account for phospholipid composition

  • Studies of how membrane domains affect drug efflux pump localization and function

The ability to manipulate cardiolipin levels in a controlled manner, while recognizing the regulatory constraints observed in previous studies , provides a valuable experimental approach for addressing these questions in clinically relevant isolates.

What synthetic biology applications could leverage recombinant cardiolipin synthase expression?

Synthetic biology approaches could utilize recombinant cardiolipin synthase in several innovative ways that extend beyond traditional molecular biology applications:

Designer cell membranes:
By combining cls gene expression with other phospholipid biosynthesis genes in carefully designed genetic circuits, synthetic biologists could potentially create bacterial strains with customized membrane compositions. These could serve as specialized chassis for various biotechnological applications.

Membrane protein production systems:
Given cardiolipin's role in supporting membrane protein function, engineered strains with optimized cardiolipin levels might serve as improved hosts for the expression of challenging membrane proteins, including those with pharmaceutical relevance.

Biosensors and conditional systems:
The growth phenotypes associated with cardiolipin deficiency under specific conditions suggest potential applications in biosensor development. For example, conditional cls expression could be coupled to detection systems for relevant environmental stimuli.

Minimal cell projects:
Understanding which phospholipids are essential under various conditions contributes to efforts to create minimal cell systems. The observation that cls mutation alone causes growth defects provides insights into the requirements for minimal viable bacterial membranes.

When designing such applications, researchers should consider:

  • The tight regulation of cardiolipin levels observed in vivo (maximum 1.5-fold increase despite higher enzyme activity)

  • The potential growth effects of cls overexpression in certain genetic backgrounds

  • The complex interplay between different phospholipid species in maintaining membrane function

Why might researchers observe discrepancies between cls gene expression levels and measurable cardiolipin synthase activity?

The observed non-linear relationship between cls gene copy number, enzyme activity, and in vivo cardiolipin levels presents an interpretive challenge for researchers. Several mechanisms could explain these discrepancies:

Transcriptional and translational constraints:

  • Feedback inhibition of transcription despite high gene copy number

  • mRNA stability issues limiting effective transcript levels

  • Inefficient translation due to codon usage or other factors

  • Protein folding limitations leading to inactive enzyme forms

Enzymatic and biochemical factors:

  • Limited membrane integration capacity for the enzyme

  • Substrate availability constraints (phosphatidylglycerol)

  • Product inhibition of enzyme activity

  • Dependence on membrane physical properties for optimal activity

Experimental and methodological considerations:

  • Assay limitations in detecting full enzyme activity

  • Extraction efficiency differences between samples

  • Enzyme instability during membrane preparation

  • Host strain variations affecting expression efficiency

To address these issues, researchers should:

  • Employ multiple complementary techniques to assess expression (RT-PCR, Western blotting, activity assays)

  • Ensure adequate substrate availability in in vitro assays

  • Control for membrane preparation variables across samples

  • Consider the impact of growth conditions on expression and activity

Understanding these regulatory mechanisms is not merely a technical concern but provides fundamental insights into how bacteria maintain membrane homeostasis.

What strategies can mitigate growth inhibition caused by cls overexpression in sensitive genetic backgrounds?

The observation that high-copy-number plasmids containing the cls gene inhibit growth of pss-1 mutants under selective conditions presents a technical challenge for researchers working with these strains. Several strategies can help mitigate this issue:

Vector and expression system optimization:

  • Use low-copy-number vectors like mini-F derivatives to limit expression levels

  • Employ tightly regulated inducible promoters to control expression timing and level

  • Consider integrating single copies into the chromosome rather than using plasmid systems

  • Design expression constructs with attenuated translation efficiency if appropriate

Growth condition adjustments:

  • Lower the growth temperature (growth inhibition was observed at 42°C but not at 30°C)

  • Modify media composition to reduce stress on membrane systems

  • Implement fed-batch or controlled growth systems that limit growth rate

  • Adjust induction timing to allow sufficient initial growth before expression

Strain engineering approaches:

  • Use wild-type strains rather than those with mutations affecting phospholipid metabolism

  • Consider suppressor mutations that might allow higher tolerance to cls overexpression

  • Balance cls expression with modified expression of other phospholipid biosynthesis genes

The appropriate strategy depends on specific research objectives. For complementation studies, low expression levels may be sufficient, while protein production goals might require more sophisticated approaches to balance expression with cellular viability.

What technical considerations are essential when establishing activity assays for recombinant cardiolipin synthase?

Developing reliable activity assays for recombinant cardiolipin synthase requires careful attention to several technical factors:

Membrane preparation considerations:

  • Gentle isolation methods to maintain enzyme integrity

  • Standardized procedures to ensure consistent membrane fraction quality

  • Appropriate buffer compositions to preserve activity

  • Careful protein quantification for accurate specific activity calculations

Assay conditions optimization:

  • Determination of optimal pH, temperature, and ionic conditions

  • Identification of appropriate detergent types and concentrations, if needed

  • Ensuring adequate substrate (phosphatidylglycerol) availability

  • Establishing linearity with respect to enzyme concentration and time

Product detection methods:

  • Sensitive and specific techniques for cardiolipin quantification

  • Appropriate standards for calibration

  • Controls for extraction efficiency

  • Consideration of background cardiolipin levels

Validation approaches:

  • Correlation of in vitro activity with in vivo cardiolipin levels

  • Comparison with wild-type enzyme activity levels

  • Confirmation of activity in complementation assays

  • Testing of known or predicted inhibitors

When interpreting results, researchers should be aware of the non-linear relationship observed between enzyme activity levels and in vivo cardiolipin content . This suggests complex regulatory mechanisms that might also affect in vitro activity measurements, depending on assay conditions.

How can researchers confirm the functional integrity of recombinant cardiolipin synthase for structural and mechanistic studies?

Confirming the functional integrity of recombinant cardiolipin synthase is essential for structural studies and mechanistic investigations. Multiple complementary approaches provide robust validation:

Biochemical verification:

  • Size confirmation through SDS-PAGE (expected molecular weight approximately 46,000 Da)

  • Mass spectrometry to verify protein identity and integrity

  • Kinetic analysis to determine parameters like Km and Vmax

  • Substrate specificity profiling to confirm enzyme selectivity

Functional validation:

  • In vitro activity assays with appropriate controls

  • Comparison of specific activity with wild-type enzyme

  • Analysis of reaction products by chromatographic or spectrometric methods

  • Inhibition studies with known inhibitors of phospholipid biosynthesis

Genetic complementation:

  • Restoration of cardiolipin synthesis in cls mutant strains

  • Rescue of growth defects in cls pss-1 double mutants under selective conditions

  • Correlation between expression level and complementation efficiency

  • Mutation analysis of key residues to confirm structure-function relationships

Structural integrity assessment:

  • Circular dichroism to evaluate secondary structure

  • Limited proteolysis to assess domain folding

  • Thermal stability assays to determine protein quality

  • Membrane association analysis to confirm proper integration

By combining these approaches, researchers can develop a comprehensive understanding of the functional integrity of recombinant cardiolipin synthase, enabling confident interpretation of subsequent structural and mechanistic studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.