Recombinant Escherichia coli O8 Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Functional Role in Vitamin B12_{12}12 Biosynthesis

CobS is a cobamide synthase that catalyzes the attachment of the lower ligand (e.g., 5,6-dimethylbenzimidazole) to adenosylcobinamide-GDP, forming adenosylcobalamin-5′-phosphate (AdoCbl-P) (Fig. 1) . This reaction is followed by dephosphorylation via CobC to yield active cobalamin . Key findings include:

  • Substrate Specificity: CobS requires adenosylcobinamide-GDP and α-ribazole-5′-phosphate as substrates .

  • Membrane Association: CobS is an integral membrane protein localized to the inner membrane of E. coli, suggesting its role in anchoring a multienzyme complex during late-stage cobalamin synthesis .

Detrimental Effects of CobS Overexpression

Elevated CobS levels disrupt cellular viability through two mechanisms:

EffectMechanismExperimental Evidence
Proton motive force (PMF) dissipationCobS overexpression increases ethidium bromide (EtBr) accumulation, indicating PMF collapse .EtBr fluorescence assays in E. coli strains .
Membrane destabilizationCobS integration alters membrane integrity, leading to cell lysis .CFU reduction assays post-induction .

Counteractive Mechanisms:

  • Coexpression of CobC (AdoCbl-P phosphatase) and PspA (phage shock protein A) restores PMF and membrane stability .

  • In vitro studies show CobC’s association with liposomes depends on CobS presence, suggesting a membrane-stabilizing complex .

Recombinant Expression Systems

CobS has been heterologously expressed in E. coli for functional studies and bioproduction:

  • Expression Hosts: High yields are achieved in E. coli C41(DE3) and BL21(DE3) strains using plasmids with T7/lac promoters .

  • Purification Challenges: CobS resists detection via Coomassie-stained SDS-PAGE due to low expression levels but retains activity after nickel-affinity chromatography .

  • Biotechnological Applications: CobS is used in in vitro systems to synthesize novel cobamides with modified lower ligands (e.g., phenolic bases) .

Key Research Gaps and Future Directions

  • Strain-Specific Variations: While E. coli K-12 CobS is well-studied, genomic data on E. coli O8 strains (e.g., pathogenicity loci) lack references to cobS .

  • Structural Resolution: No high-resolution structure of E. coli CobS exists, hindering mechanistic insights .

  • Industrial Optimization: Enhancing CobS solubility via chaperone coexpression (e.g., GroEL/GroES) could improve cobalamin yields .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; ECIAI1_2073; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from Escherichia coli O8 catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (CobS) and what is its role in E. coli?

CobS is a polytopic, integral membrane protein involved in the nucleotide loop assembly (NLA) pathway of coenzyme B12 (cobalamin) biosynthesis. It functions as one of two crucial membrane proteins in this pathway, with CbiB being the other key component. CobS is believed to anchor a multienzyme complex that catalyzes the late steps of coenzyme B12 biosynthesis . The protein is conserved across bacteria and archaea that synthesize cobalamins, suggesting that the NLA pathway occurs in the membrane of all these organisms. The presence of CobS is essential for functional synthesis of B12-related compounds, making it a critical component of bacterial metabolism.

How does E. coli O8 differ from other E. coli strains in terms of CobS functionality?

E. coli O8:H8 strains, particularly those isolated from diarrheal outbreaks, show specific genetic characteristics that may influence CobS functionality. These strains carry prophage-encoded genes and additional genetic elements like colonization factor antigen III genes . While general CobS function remains consistent across E. coli strains, the genetic background of E. coli O8 may affect expression levels, regulation, and interactions with other cellular components. The genomic analysis of E. coli O8:H8 strains has revealed they belong to phylogroup B1 and are distinct from other O8:H8 strains found in environmental samples, suggesting potential adaptations that could affect CobS activity in these clinical isolates .

What are the structural characteristics of CobS that enable its function in cobalamin biosynthesis?

CobS is characterized by its polytopic membrane structure, with multiple transmembrane domains that anchor it firmly within the bacterial membrane. These structural features are crucial for its function in coenzyme B12 biosynthesis. The protein forms part of a larger multienzyme complex, likely including CbiB, that facilitates the coordinated steps required for cobalamin assembly . The integration of CobS into liposomes during in vitro experiments has demonstrated that its membrane-embedded structure is essential for activity. Additionally, the protein contains specific domains that interact with pathway intermediates and other enzymes involved in the biosynthetic pathway, enabling efficient catalysis of the late steps in cobalamin production.

What are the optimal conditions for recombinant expression of E. coli O8 CobS?

The optimal expression of recombinant CobS requires careful consideration of expression systems and conditions to prevent toxicity. Research indicates that balanced expression is critical, as overproduction of CobS causes membrane destabilization and growth arrest . For successful expression:

  • Expression system selection: Use tightly regulated expression vectors with inducible promoters such as pRSFDUET-1, which allows for controlled induction with IPTG.

  • Co-expression strategy: Co-express CobS with its functional partners CobC (phosphatase) and/or PspA (phage shock protein A) to counteract the detrimental effects of CobS overproduction .

  • Induction conditions: Optimize IPTG concentration (typically <0.1 mM) and induction temperature (25-30°C rather than 37°C) to minimize membrane stress.

  • Growth media: Use enriched media supplemented with glucose to support membrane protein production.

This balanced approach helps maintain cell viability while achieving sufficient protein expression for downstream applications.

What purification strategies yield functional CobS protein for in vitro studies?

Purification of functional CobS presents challenges due to its membrane-integrated nature. Effective purification strategies include:

  • Membrane isolation: Harvest cells and prepare membrane fractions through differential centrifugation, preserving native membrane environment.

  • Detergent selection: Screen mild detergents (DDM, LMNG, or CHAPS) for efficient solubilization while maintaining protein stability and function.

  • Affinity purification: Utilize affinity tags (His-tag, FLAG-tag) positioned to avoid interference with membrane insertion or function.

  • Reconstitution: For functional studies, incorporate purified CobS into liposomes composed of E. coli lipids to recreate the native membrane environment .

The reconstitution step is particularly critical for functional analysis, as CobS activity has been successfully demonstrated in liposome systems, confirming the importance of the membrane environment for proper protein function .

How can researchers confirm the functional integrity of purified CobS?

Verifying functional integrity of purified CobS can be accomplished through multiple complementary approaches:

  • Liposome incorporation assays: Assess proper membrane integration by confirming CobS incorporation into liposomes using density gradient centrifugation or protease protection assays.

  • Proton motive force (PMF) measurements: Functional CobS affects membrane potential, which can be measured using fluorescent dyes such as DiOC or ethidium bromide accumulation assays .

  • Enzyme activity assays: Measure the ability of CobS to participate in cobalamin synthesis by monitoring conversion of pathway intermediates using HPLC or mass spectrometry.

  • Interaction studies: Confirm interactions with known partners such as CobC phosphatase, which associates with liposomes only in the presence of CobS .

A combination of these approaches provides comprehensive validation of protein functionality before proceeding to more detailed biochemical or structural studies.

How does CobS overexpression affect membrane integrity and cellular physiology?

Excessive CobS production has profound effects on bacterial membrane properties and cellular physiology:

ParameterEffect of CobS OverexpressionMeasurement MethodReference
Proton Motive ForceSignificant dissipationEthidium bromide accumulation assay
Membrane PermeabilityIncreasedTO-PRO-3 uptake assay
Membrane PotentialDecreasedDiOC fluorescence
Cell MorphologyFilamentation, lack of divisional septaMicroscopy
Cell ViabilityArrested growth, eventual cell deathViability assays

These observations suggest that imbalanced expression of CobS disrupts membrane organization, potentially by altering lipid-protein interactions or creating non-specific pores. The dissipation of PMF appears to be a primary mechanism leading to growth arrest, as the PMF is essential for proper cell division and energy-dependent cellular processes. The cell filamentation observed indicates defects in divisome assembly and possibly DNA replication, which are known to depend on intact membrane potential .

What is the relationship between CobS and other proteins in the cobalamin biosynthesis pathway?

CobS functions within a coordinated network of proteins in the cobalamin biosynthesis pathway:

  • CbiB interaction: CbiB (AdoCbi-P synthase) is the second polytopic membrane protein in the NLA pathway, likely forming a functional complex with CobS to coordinate late steps of B12 synthesis .

  • CobC cooperation: CobC phosphatase catalyzes the final reaction in CoB12 biosynthesis and counteracts the negative effects of CobS overproduction. The association of CobC with liposomes depends on the presence of CobS, suggesting a direct interaction between these proteins within the membrane .

  • PspA regulatory role: Phage shock protein A (PspA) ameliorates the detrimental effects of CobS overproduction, likely by stabilizing the membrane against stress. Co-expression of PspA with CobS restores cell viability and reduces membrane permeability .

This network of interactions indicates that CobS functions as part of a larger multienzyme complex anchored in the membrane, where coordinated expression and assembly are critical for proper pathway function and cell survival.

How do mutations in the cobS gene affect its function and E. coli physiology?

Mutations in cobS can have varying effects depending on the nature and location of the mutation:

  • Catalytic site mutations: Mutations affecting the active site, such as D82A, render the protein catalytically inactive but still cause membrane destabilization when overexpressed, indicating that membrane disruption is partly independent of catalytic activity .

  • Transmembrane domain mutations: Alterations in membrane-spanning regions can affect protein folding, membrane insertion, and complex formation, potentially disrupting both function and membrane integrity.

  • Interaction domain mutations: Mutations in regions mediating protein-protein interactions may preserve catalytic function but disrupt coordination with other pathway components, leading to accumulation of toxic intermediates.

The physiological consequences of these mutations highlight the dual role of CobS as both a catalytic enzyme and a structural component of a membrane-associated multienzyme complex, where proper folding and integration are as critical as enzymatic activity.

How can recombinant E. coli O8 CobS be utilized in synthetic biology applications?

Recombinant CobS offers several potential applications in synthetic biology:

  • Engineered B12 production: Optimized expression of CobS alongside other pathway components can enhance cobalamin production in engineered strains, potentially addressing B12 deficiency through microbial synthesis.

  • Membrane protein expression platform: The lessons learned from CobS expression—particularly the importance of balanced co-expression with stabilizing partners like PspA—provide valuable strategies for expressing other challenging membrane proteins.

  • Biosensor development: The membrane-disruptive effects of CobS could be harnessed to create biosensors where controlled membrane permeabilization triggers detectable signals in response to specific environmental conditions.

  • Metabolic engineering: Understanding CobS function enables rational modification of B12-dependent metabolic pathways, potentially redirecting metabolism toward valuable products like biofuels or pharmaceuticals.

These applications require careful tuning of expression levels to harness CobS functionality while avoiding toxicity, highlighting the importance of regulated expression systems and co-expression strategies.

What computational approaches can predict protein-protein interactions involving CobS?

Several computational methods can elucidate CobS protein interactions:

  • Molecular dynamics simulations: Simulations of CobS within lipid bilayers can reveal conformational changes and identify potential interaction interfaces with partners like CbiB and CobC.

  • Co-evolutionary analysis: Methods such as direct coupling analysis (DCA) can identify co-evolving residue pairs between CobS and other pathway proteins, suggesting physical contact points.

  • Integrative modeling: Approaches combining experimental constraints (cross-linking data, low-resolution structural information) with computational modeling can generate testable models of the CobS-containing multienzyme complex.

  • Network analysis: Integration of CobS into larger metabolic models, similar to the comprehensive E. coli model mentioned in search result , can identify functional relationships beyond direct physical interactions.

These computational approaches can guide experimental design by identifying key residues for mutagenesis and suggesting specific hypotheses about complex assembly and function.

How can structural studies of CobS inform our understanding of cobalamin biosynthesis?

Structural characterization of CobS would significantly advance our understanding of cobalamin biosynthesis:

  • Membrane integration mechanism: Structural studies could reveal how CobS integrates into the membrane and forms a functional complex with CbiB and other components.

  • Substrate channeling insights: The structure could elucidate how pathway intermediates are channeled between enzymes in the multiprotein complex, explaining the efficiency of the biosynthetic process.

  • Cofactor binding sites: Identification of binding sites for cobalamin intermediates would clarify the catalytic mechanism and potentially enable rational design of inhibitors or enhancers.

  • Conformational dynamics: Similar to the "molecular juggling" observed in cobalamin-dependent methionine synthase , CobS may undergo conformational changes during catalysis that could be captured through structural studies.

Recent advances in membrane protein structural biology, including cryo-electron microscopy and in situ structural techniques, make these studies increasingly feasible despite the challenges posed by membrane proteins.

How can researchers address toxicity issues when expressing recombinant CobS?

Toxicity during CobS expression can be mitigated through several strategies:

  • Balanced co-expression: Co-express CobS with CobC and/or PspA, which have been demonstrated to counteract the membrane-disruptive effects of CobS overproduction . The pRSFDUET-1 expression system allows for controlled co-expression of these proteins.

  • Induction optimization: Carefully titrate inducer (IPTG) concentration to find the balance between protein expression and cell viability. Research indicates that even at low IPTG concentrations (0.01-0.05 mM), significant toxicity can occur with CobS alone, but co-expression with CobC or PspA allows higher expression levels .

  • Expression strain selection: Use E. coli strains with enhanced membrane protein expression capabilities, such as C41(DE3) or C43(DE3), which are better adapted to tolerate membrane protein overexpression.

  • Growth condition modification: Lower growth temperature (25-30°C), use rich media with glucose, and harvest cells earlier in the induction phase to minimize cumulative toxic effects.

These approaches align with the experimental evidence showing that balanced expression of CobS with its functional partners maintains cell viability while allowing sufficient protein production .

What methods can resolve data inconsistencies in CobS functional studies?

Resolving data inconsistencies in CobS research requires systematic approaches:

  • Standardized assay conditions: Develop standardized protocols for membrane preparation, liposome reconstitution, and activity assays to ensure reproducibility across laboratories.

  • Multiple complementary assays: Apply diverse methodologies to measure the same parameter—for example, assess membrane integrity using both fluorescent dye uptake and electrical measurements.

  • Integrated data analysis: Use mathematical modeling approaches similar to those described in search result to cross-evaluate heterogeneous datasets and identify inconsistencies.

  • Deep curation: Implement a "deep curation" approach as mentioned in , where multiple layers of data are thoroughly examined and interconnected through mechanistic models.

  • Control experiments: Include appropriate controls for each experiment, particularly accounting for the effects of membrane protein overexpression generally versus specific CobS-mediated effects.

This systematic approach can help distinguish between genuine biological phenomena and experimental artifacts, leading to more consistent and reliable results.

How can researchers differentiate between direct CobS effects and secondary consequences?

Distinguishing direct CobS effects from downstream consequences requires careful experimental design:

  • Time-course analysis: Monitor cellular changes immediately following CobS induction to identify primary effects before secondary consequences develop.

  • Catalytic vs. structural mutations: Compare wild-type CobS with catalytically inactive mutants (e.g., D82A) that maintain structural integrity. Similar membrane disruption observed with both proteins suggests these effects are direct structural consequences rather than dependent on catalytic activity .

  • Isolated system reconstitution: Use purified components in liposome systems to test specific biochemical activities and interactions without cellular complexity.

  • Transcriptomic and proteomic analysis: Monitor global changes in gene expression and protein levels following CobS induction to identify cellular response pathways activated by CobS expression.

  • Suppressor screening: Identify genetic suppressors that alleviate CobS toxicity, potentially revealing direct interaction partners or compensatory mechanisms.

These approaches help build a causal map of CobS effects, distinguishing between primary mechanisms and secondary adaptations or consequences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.