Recombinant Escherichia coli O8 Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

Expression System

  • Host: Escherichia coli

  • Vector: Optimized plasmids for high-yield expression

  • Purification: Affinity chromatography via His tag

Yield Optimization

  • Secretion efficiency enhanced by modifying 5' untranslated regions and deleting flagellar genes (e.g., fliC, fliD) to reduce inclusion body formation .

Biochemical and Functional Roles

Electron Transport Mechanism

  • Primary Function: Mediates electron transfer between ferredoxin and NAD+, coupled with Na+ translocation .

  • Redox Partners:

    • Ferredoxin (electron donor)

    • NAD+ (electron acceptor)

Ion Translocation

  • The Rnf complex generates a sodium gradient (ΔμNa+) during electron transfer, which drives ATP synthesis .

  • Experimental evidence from Acetobacterium woodii confirms electrogenic Na+ transport linked to Rnf activity .

Enzymatic Activity

SubstrateProductCofactorActivity (Reported)
FerredoxinNADHNa+4 mg/L secreted protein

Research Applications

  • Metabolic Engineering: Used to study ion-coupled energy conservation in anaerobic bacteria .

  • Biotechnological Tools:

    • Platform for probing membrane protein topology via PhoA fusions

    • Antigen for antibody production in ELISA assays

  • Drug Target: Potential candidate for disrupting bacterial bioenergetics in pathogenic strains .

Evolutionary and Physiological Context

  • Homologs: RnfE shares structural homology with Rhodobacter capsulatus RnfA (20% sequence identity) but differs in membrane orientation .

  • Conservation: The Rnf complex is evolutionarily widespread in bacteria and archaea, underscoring its role in anaerobic respiration .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs by default. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rsxE; ECIAI1_1684; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
rsxE
Target Protein Sequence
MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRAEATAERALPNGETGNV
Uniprot No.

Target Background

Function
RnfE is a component of a membrane-bound complex that couples electron transfer with ion translocation across the membrane. It plays a crucial role in maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the RnfE protein and what is its role in E. coli O8?

The RnfE protein (also known as rsxE) is a component of the electron transport complex in Escherichia coli O8. It functions as an ion-translocating oxidoreductase complex subunit E within the Rsx electron transport complex. The protein consists of 231 amino acids and plays a critical role in electron transfer processes within the bacterial cell membrane. The protein contains transmembrane domains that facilitate ion translocation across the membrane, contributing to energy conservation processes in E. coli .

Why is recombinant expression of RnfE protein important for research?

Recombinant expression of RnfE protein is essential for detailed structural and functional studies that would be difficult with native protein isolation. By expressing RnfE in controlled systems, researchers can:

  • Produce sufficient quantities for biochemical and biophysical characterization

  • Introduce specific mutations to study structure-function relationships

  • Add tags (such as His-tags) to facilitate purification and detection

  • Express the protein in various host systems to optimize folding and activity

  • Generate protein for antibody production and immunological studies

These advantages make recombinant expression the preferred approach for studying membrane proteins like RnfE that are often present in low abundance in their native environments .

What expression systems are suitable for recombinant RnfE protein production?

E. coli remains the most widely used expression system for recombinant RnfE protein due to its rapid growth, high protein yields, and ease of genetic manipulation. The expression can be optimized using various E. coli strains designed for membrane protein expression. While E. coli BL21(DE3) is commonly used, specialized strains like C41(DE3) or C43(DE3) may provide better results for membrane proteins like RnfE.

The optimal expression conditions typically include:

  • Growth temperature: 25-30°C to enhance proper folding

  • Induction with low IPTG concentrations (0.1-0.5 mM)

  • Growth in rich media containing yeast extract and tryptone

  • Inclusion of glucose for catabolite repression

  • Use of appropriate antibiotic selection (e.g., kanamycin at 30 μg/mL)

These parameters can be further optimized using experimental design approaches as demonstrated in similar recombinant protein expression studies .

How can I confirm the identity and integrity of purified recombinant RnfE protein?

Multiple analytical methods should be employed to verify the identity and structural integrity of purified recombinant RnfE:

  • SDS-PAGE analysis: To assess protein purity and approximate molecular weight

  • Western blotting: Using anti-His antibodies for tagged protein detection

  • Mass spectrometry: For accurate molecular weight determination and peptide mapping

  • N-terminal sequencing: To confirm the correct protein sequence

  • Circular dichroism (CD) spectroscopy: To evaluate secondary structure elements

  • Functional assays: To confirm electron transport activity of the purified protein

Purity greater than 90% as determined by SDS-PAGE is generally considered acceptable for most research applications .

What experimental design approaches can optimize soluble RnfE protein expression?

Factorial design methodology provides a robust approach for optimizing soluble RnfE expression. This statistical technique allows researchers to evaluate multiple variables simultaneously, identifying significant factors affecting protein expression while minimizing experimental resources.

For RnfE expression optimization, consider implementing a 2^k factorial design (where k represents the number of variables) to evaluate:

  • Medium composition variables:

    • Yeast extract concentration (2-10 g/L)

    • Tryptone concentration (2-10 g/L)

    • NaCl concentration (5-10 g/L)

    • Glucose concentration (0-2 g/L)

    • Antibiotic concentration (20-50 μg/mL)

  • Induction conditions:

    • IPTG concentration (0.1-1.0 mM)

    • Induction temperature (16-30°C)

    • Cell density at induction (OD600 0.4-1.0)

    • Induction duration (3-18 hours)

This approach allows for the systematic identification of optimal conditions that maximize soluble protein yield while maintaining functional activity .

How can I assess the functional activity of recombinant RnfE protein?

Assessing functional activity of recombinant RnfE protein requires specialized assays that evaluate electron transport capability:

  • Electron transfer assays: Measuring electron transfer rates using artificial electron donors/acceptors

  • Redox potential measurements: Using potentiometric titrations with redox-sensitive dyes

  • Membrane reconstitution studies: Incorporating purified RnfE into liposomes to assess ion translocation

  • Oxygen consumption measurements: Using oxygen electrodes to monitor respiratory activity

  • Spectroscopic analyses: Monitoring absorbance changes associated with electron transfer processes

For meaningful results, activity assays should include appropriate positive and negative controls, and data should be normalized to protein concentration to calculate specific activity values.

What are the challenges in structural characterization of recombinant RnfE protein?

Structural characterization of RnfE protein faces several challenges due to its membrane-associated nature:

  • Protein solubility issues: The hydrophobic transmembrane regions make RnfE prone to aggregation during purification

  • Detergent selection: Finding optimal detergents that maintain protein structure while allowing crystallization

  • Conformational heterogeneity: Membrane proteins often exhibit multiple conformational states

  • Crystal formation difficulties: Membrane proteins are notoriously difficult to crystallize

  • Protein stability concerns: RnfE may demonstrate reduced stability outside its native membrane environment

To address these challenges, researchers should consider:

  • Screening multiple detergents for protein extraction

  • Using fusion partners that enhance solubility

  • Employing lipid cubic phase crystallization methods

  • Exploring alternative structural techniques like cryo-electron microscopy

  • Conducting limited proteolysis to identify stable domains for structural studies

How do genetic modifications impact RnfE protein expression and function?

Genetic modifications can significantly affect RnfE expression and functional properties:

Modification TypePotential Impact on ExpressionEffect on Protein FunctionRecommended Analysis Method
Codon optimization1.5-3× increase in yieldMinimal impact if sequence preservedSDS-PAGE, Western blot
Signal sequence modificationImproved membrane targetingMay alter membrane insertionSubcellular fractionation
Fusion tags (N-terminal)Enhanced solubility, potential folding issuesPossible interference with N-terminal functionActivity assays with/without tag cleavage
Fusion tags (C-terminal)Improved detection and purificationMinimal impact on membrane insertionComparative activity assays
Transmembrane domain alterationsReduced membrane integrationSignificant loss of functionMembrane integration analysis
Point mutations in conserved residuesVariable expression effectsIdentification of functional residuesSite-directed mutagenesis studies

When introducing genetic modifications, it is essential to verify that the recombinant protein maintains its native folding and functional properties through careful comparative analysis .

What purification strategies are most effective for recombinant RnfE protein?

Purification of recombinant RnfE protein requires a carefully designed strategy that preserves protein structure and function:

  • Membrane protein extraction:

    • Cell lysis using French press or sonication in buffer containing protease inhibitors

    • Membrane fraction isolation through differential centrifugation

    • Solubilization using appropriate detergents (DDM, LDAO, or Triton X-100)

  • Affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged RnfE

    • Careful optimization of imidazole concentration in wash and elution buffers

    • Consideration of detergent concentration throughout purification

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for additional purity

    • Specialized membrane protein purification techniques if needed

  • Quality control:

    • SDS-PAGE analysis for purity assessment (>90% purity)

    • Western blot confirmation of identity

    • Activity assays to confirm functional integrity

For optimal results, all buffers should contain the appropriate detergent at concentrations above the critical micelle concentration (CMC) to maintain protein solubility .

How can I troubleshoot poor expression or insolubility of recombinant RnfE?

When facing challenges with recombinant RnfE expression or solubility, systematic troubleshooting approaches include:

  • Expression level issues:

    • Optimize codon usage for E. coli expression

    • Test different promoter systems (T7, tac, ara)

    • Evaluate various E. coli strains specialized for membrane proteins

    • Reduce expression temperature (16-25°C) to slow protein synthesis

    • Investigate autoinduction media formulations

  • Protein solubility problems:

    • Screen multiple detergents for membrane extraction

    • Add solubility-enhancing additives (glycerol, specific lipids)

    • Consider fusion partners known to enhance solubility

    • Evaluate directed evolution approaches to select for soluble variants

  • Protein quality concerns:

    • Implement co-expression with molecular chaperones

    • Optimize cell lysis and extraction conditions

    • Consider mild solubilization approaches using native-like environments

When implementing these strategies, maintain a systematic approach by changing only one variable at a time or using statistical design of experiments (DoE) methodology to efficiently identify optimal conditions .

What are the considerations for scaling up recombinant RnfE protein production?

Scaling up RnfE protein production from laboratory to larger volumes requires addressing several key considerations:

  • Growth conditions optimization:

    • Maintain consistent dissolved oxygen levels through improved aeration

    • Implement fed-batch strategies to control nutrient availability

    • Monitor and control pH throughout cultivation

    • Determine optimal induction parameters at scale

  • Process modifications:

    • Adapt cell harvesting methods for larger volumes

    • Scale membrane preparation protocols appropriately

    • Modify protein extraction procedures for increased biomass

    • Adjust chromatography strategies for larger sample volumes

  • Quality considerations:

    • Implement in-process monitoring to ensure consistent protein quality

    • Establish quality control metrics for batch consistency

    • Validate purification efficiency at larger scale

    • Confirm functional activity of scaled-up protein preparations

Successful scale-up typically requires iterative optimization, beginning with small-scale process characterization before progressively increasing production volume .

How can structural biology techniques be applied to study RnfE protein?

Multiple structural biology approaches can provide valuable insights into RnfE protein structure and function:

  • X-ray crystallography:

    • Requires high-purity, homogeneous protein preparations

    • Extensive crystallization condition screening

    • Consideration of lipidic cubic phase crystallization for membrane proteins

    • Potential use of antibody fragments to stabilize protein conformation

  • Cryo-electron microscopy (cryo-EM):

    • Increasingly powerful for membrane protein structure determination

    • May reveal multiple functional states

    • Can visualize protein in more native-like environments

    • Less dependent on crystal formation

  • NMR spectroscopy:

    • Most suitable for specific domains rather than full-length RnfE

    • Requires isotopic labeling (15N, 13C) of the recombinant protein

    • Can provide dynamic information not accessible by other methods

    • Challenging for large membrane proteins but valuable for specific interactions

  • Computational methods:

    • Homology modeling based on related structures

    • Molecular dynamics simulations to study conformational changes

    • Docking studies to investigate ligand interactions

    • Integration with experimental data for comprehensive structural insights

The complementary use of multiple techniques often provides the most complete structural understanding of complex membrane proteins like RnfE .

What is the phylogenetic distribution of RnfE protein among bacterial species?

RnfE protein shows interesting phylogenetic distribution patterns across bacterial species:

  • The electron transport complex containing RnfE is conserved across various bacterial phyla, including Proteobacteria, Firmicutes, and others

  • Sequence analysis reveals distinct evolutionary clusters that correlate with bacterial taxonomy

  • E. coli O8 RnfE shows specific sequence characteristics that may relate to its ecological niche

  • Comparative genomic studies indicate that RnfE is part of a larger operon structure that is maintained across related species

  • Horizontal gene transfer events have likely contributed to the distribution of RnfE genes across bacterial lineages

Understanding the phylogenetic distribution provides insights into the evolutionary history and functional importance of this protein in bacterial energy metabolism .

How does RnfE contribute to bacterial energy metabolism and pathogenesis?

RnfE, as part of the electron transport complex, plays several crucial roles in bacterial physiology:

  • Energy metabolism:

    • Contributes to ion gradient formation across bacterial membranes

    • Participates in redox balancing during anaerobic growth

    • Supports NAD+/NADH homeostasis in the cell

    • May provide alternative electron transport pathways under stress conditions

  • Pathogenesis relevance:

    • E. coli O8 strains have been associated with various human diseases

    • Energy metabolism flexibility can contribute to survival in host environments

    • Electron transport capabilities may support colonization and persistence

    • May provide resistance to host-derived oxidative stress

  • Ecological adaptations:

    • Contributes to metabolic versatility in diverse environments

    • Supports growth under fluctuating nutrient conditions

    • May enable utilization of alternative electron acceptors

    • Could provide competitive advantages in specific niches

Further research is needed to fully elucidate the role of RnfE in pathogenic E. coli O8 strains and its potential as a therapeutic target .

What are emerging approaches for studying RnfE protein function?

Several cutting-edge approaches show promise for advancing our understanding of RnfE function:

  • Single-molecule techniques:

    • FRET-based approaches to monitor conformational changes

    • Atomic force microscopy for mechanical properties

    • Single-molecule electrophysiology for ion transport studies

  • Advanced imaging methods:

    • Super-resolution microscopy to visualize membrane localization

    • Correlative light and electron microscopy for structural context

    • Live-cell imaging with fluorescent protein fusions

  • Systems biology integration:

    • Multi-omics approaches to place RnfE in broader metabolic context

    • Network analysis to identify functional partners

    • Computational modeling of electron transport systems

  • Synthetic biology applications:

    • Designer electron transport chains incorporating modified RnfE

    • Biosensor development based on RnfE properties

    • Metabolic engineering applications utilizing RnfE functions

These emerging approaches will likely provide new insights into the fundamental biology of bacterial electron transport and energy conservation mechanisms .

What are the key unresolved questions about RnfE protein structure and function?

Despite progress in characterizing RnfE protein, several important questions remain unresolved:

  • The high-resolution structure of RnfE and its organization within the larger electron transport complex

  • The precise mechanism of ion translocation and coupling to electron transfer

  • The regulatory mechanisms controlling RnfE expression and activity under different conditions

  • The specific roles of conserved amino acid residues in protein function

  • The interaction partners and protein-protein interfaces within the complete complex

  • The potential for RnfE as a target for antimicrobial development

  • The contribution of RnfE to bacterial fitness and virulence in infection models

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, molecular genetics, and computational modeling .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.