Recombinant Escherichia coli O8 Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Description

Introduction

Fumarate reductase (Frd) is a crucial enzyme in the anaerobic metabolism of many bacteria, including Escherichia coli . It enables the bacterium to use fumarate as a terminal electron acceptor in place of oxygen . The enzyme complex, encoded by the frdABCD operon, catalyzes the final step of anaerobic respiration .

Structure and Function of Fumarate Reductase

Fumarate reductase consists of four subunits: FrdA, FrdB, FrdC, and FrdD . These subunits contain flavin adenine dinucleotide, iron-sulfur clusters, and quinones, which are arranged to facilitate electron transfer from the membrane-bound quinone to the active site flavin . FrdC and FrdD are integral membrane proteins required for membrane association of fumarate reductase and for the oxidation of reduced quinone analogues .

Regulation of Fumarate Reductase Expression

Expression of the frdABCD operon is regulated at the transcriptional level in response to the availability of electron acceptors such as oxygen, fumarate, and nitrate . Anaerobic conditions induce frdA'-'lacZ expression, while nitrate represses it . The fnr gene product, Fnr, is responsible for the anaerobic activation of frd operon expression .

Role in Anaerobic Respiration

Fumarate reductase allows E. coli to grow anaerobically by utilizing fumarate as a terminal electron acceptor . Introduction of all four fumarate reductase subunits into an E. coli strain lacking a chromosomal frd operon is essential for the restoration of anaerobic growth on glycerol and fumarate .

Role in Virulence

Fumarate, a catabolite of succinate dehydrogenase (Sdh), plays a critical role in the regulation of E. coli virulence . Disruption of succinate dehydrogenase (sdhB) and fumarate reductase (frdA) affects the fitness of uropathogenic E. coli (UPEC) during urinary tract infection (UTI) . Specifically, the oxidative fumarase FumC is a key contributor to E. coli fitness under iron-limitation and during UTI .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us for preferential development.
Synonyms
frdC; ECIAI1_4389; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized during anaerobic growth, while succinate dehydrogenase functions in aerobic growth. FrdC anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Fumarate reductase in E. coli and what is the role of subunit C (frdC)?

Fumarate reductase in E. coli is a membrane-bound enzyme that catalyzes the reduction of fumarate to succinate under anaerobic conditions. It is distinct from succinate dehydrogenase, as it is specifically induced anaerobically in the presence of fumarate and repressed during aerobic growth . The enzyme consists of four subunits (FrdA, FrdB, FrdC, and FrdD) with a quaternary structure critical for functionality.

FrdC is a 15 kDa hydrophobic protein that serves as one of two membrane anchor subunits of the complex . Both FrdC and FrdD are required for membrane association of fumarate reductase and for the oxidation of reduced quinone analogues . Without these membrane anchor subunits, the catalytic dimer of FrdA and FrdB remains soluble and cannot participate effectively in electron transport chains.

Methodologically, researchers investigating frdC should consider its transmembrane nature when designing expression systems and purification protocols, as the hydrophobic character presents specific challenges for structural and functional studies.

How is the frdABCD operon structured and regulated?

The frdABCD operon in E. coli encodes all four subunits of the fumarate reductase enzyme in a single transcriptional unit. The expression of this operon is tightly regulated by environmental conditions:

  • Oxygen regulation: The operon is repressed during aerobic growth and induced under anaerobic conditions

  • Fumarate dependence: Expression requires the presence of fumarate as terminal electron acceptor

  • Structural arrangement: The gene order (frdA, frdB, frdC, frdD) is functionally significant

Experimental evidence has demonstrated that separation of the DNA coding for FrdC and FrdD proteins affects the ability of fumarate reductase to assemble into a functional complex . This highlights the importance of the operon's structural integrity for proper enzyme function and assembly.

For researchers, this suggests that when designing recombinant expression systems, the natural gene order should be maintained whenever possible. Furthermore, experimental conditions should control oxygen levels and fumarate availability to ensure appropriate expression.

What experimental methods are commonly used to study recombinant frdC?

Several methodological approaches have proven effective for studying recombinant frdC:

MethodApplicationKey Considerations
Recombinant DNA techniquesConstruction of expression plasmidsMaintain operon structure; select appropriate promoters
Expression systemsProtein productionOptions include E. coli, yeast, baculovirus, and mammalian cells
Protein taggingPurification and detectionAviTag-BirA biotinylation technology can be used for specific tagging
Membrane protein purificationIsolation of functional proteinRequires careful detergent selection to maintain structure
Complementation assaysFunctional analysisUse of E. coli strains lacking chromosomal frd operon
Two-dimensional gel electrophoresisProtein quantificationCan identify and measure both large and small fumarate reductase subunits
Enzyme activity assaysFunctional analysisBenzyl viologen oxidase assay; fumarate to succinate conversion

When designing experiments, researchers should consider that membrane proteins like frdC present unique challenges. For instance, standard SDS-PAGE may not accurately represent membrane protein molecular weights, and maintaining the protein in a functional state often requires specific detergents or lipid environments.

How does the complete fumarate reductase enzyme function in E. coli metabolism?

Fumarate reductase plays a central role in anaerobic respiration in E. coli through the following mechanisms:

  • Electron transport: The enzyme accepts electrons from reduced quinones in the membrane, facilitated by the FrdC and FrdD subunits

  • Terminal electron acceptor: Under anaerobic conditions, fumarate serves as the terminal electron acceptor (replacing oxygen)

  • Energy conservation: The reduction of fumarate contributes to proton motive force generation

  • Metabolic integration: The reaction connects to central carbon metabolism through the TCA cycle

For the enzyme to function properly, glucose is typically required for the conversion of fumarate to succinate, presumably to provide reducing equivalents . Studies with recombinant E. coli strains containing amplified fumarate reductase activity have demonstrated significantly higher rates and yields of succinate production compared to wild-type strains .

Experimental data has shown that in the absence of glucose or in cultures with low cell density, malate can accumulate instead of succinate , highlighting the importance of experimental conditions when studying this enzyme.

How can recombinant E. coli strains with amplified fumarate reductase activity be engineered?

Engineering E. coli strains with enhanced fumarate reductase activity requires a multifaceted approach:

  • Plasmid-based amplification strategies:

    • Use of high-copy number plasmids containing the frd operon

    • Selection of compatible promoters for controlled expression

    • Incorporation of appropriate regulatory elements

  • Strain optimization approaches:

    • Two recombinant plasmid E. coli strains (JRG1233 and JRG1346) containing amplified fumarate reductase activity converted fumarate to succinate at significantly higher rates and yields than wild-type E. coli

    • Two-dimensional gel electrophoresis confirmed increased quantities of both large and small fumarate reductase subunits in these recombinant strains

  • Metabolic considerations:

    • Glucose is required for efficient conversion of fumarate to succinate

    • In the absence of glucose or with low cell density, malate accumulation may occur instead of succinate production

  • Expression regulation:

    • Cole and Guest reported that E. coli mutants amplified up to 32-fold in fumarate reductase activity contain both membrane-bound and soluble (cytoplasmic) forms of the enzyme

    • Once membrane binding capacity is saturated (estimated at 8-10 times normal levels), additional synthesis leads to cytoplasmic accumulation

    • Only membrane-bound fumarate reductase may contribute to whole-cell conversion of fumarate to succinate

For researchers, these findings suggest that there may be an optimal level of fumarate reductase amplification beyond which further increases yield diminishing returns in terms of succinate production.

What are the challenges in expressing functional fumarate reductase subunits in heterologous systems?

Expressing functional fumarate reductase subunits, particularly membrane components like frdC, presents several significant challenges:

These challenges highlight the importance of holistic approaches when designing expression systems for complex multi-subunit membrane proteins like fumarate reductase.

How can metabolic flux analysis be used to assess the impact of frdC modifications on cellular metabolism?

  • 13C-MFA methodology:

    • Utilizes 13C-labeled carbon substrates to track carbon flow through metabolic pathways

    • Can reveal how genetic modifications redirect metabolic fluxes

    • Example: Studies have shown that certain gene knockouts can increase fluxes toward the pentose phosphate and tricarboxylic acid cycle pathways

  • Energy metabolism assessment:

    • Measuring ATP levels and NADPH/NADP+ ratios can reveal how frdC modifications affect cellular energetics

    • Gene modifications can trigger growth phenotypes with altered energy profiles

  • Integration with complementary approaches:

    • Metabolic flux results can be enhanced by combining with:

      • Transcriptomics data

      • Proteomics analysis

      • Enzyme activity measurements

  • Experimental design considerations:

    • Control strains are essential for comparative analysis

    • Growth conditions must be carefully standardized

    • Substrate uptake and product formation rates should be precisely measured

  • Example experimental approach:

    • In study , researchers performed 13C-MFA using a 13C-labeled carbon substrate to show increased fluxes toward specific pathways in gene-deleted strains

    • Growth parameters, glucose consumption, and metabolite production were measured to establish metabolic profiles

For researchers studying frdC modifications, MFA can reveal how alterations in fumarate reductase activity affect not only succinate production but also broader aspects of central carbon metabolism and energy generation.

What are the genetic strategies for manipulating the frdABCD gene cluster in metabolic engineering applications?

Several genetic approaches have proven effective for manipulating the frdABCD gene cluster:

  • Gene deletion strategies:

    • The frdABCD gene cluster can be deleted using homologous recombination techniques

  • Combined genetic modifications:

    • Deletion of frdABCD can be combined with other modifications for specific metabolic engineering goals

    • In US9944957B2, researchers created strains with multiple gene deletions:

      • Deletion of pflB (pyruvate formate-lyase)

      • Deletion of frdABCD (fumarate reductase)

      • Deletion of mgsA (methylglyoxal synthase)

  • Plasmid-based complementation:

    • Construction of recombinant plasmids carrying portions of the E. coli frd operon

    • Expression can be examined by in vivo complementation in strains lacking chromosomal frd operon

    • This approach can verify the functional requirements of specific subunits

  • Promoter engineering:

    • Modifying promoter elements to control expression levels

    • Using inducible systems to regulate expression timing and intensity

These strategies provide researchers with a toolkit for manipulating fumarate reductase expression and activity to achieve specific metabolic engineering goals, such as enhanced succinate production or redirected carbon flux.

How do researchers address data contradictions in frdC structure-function studies?

Addressing contradictory data in frdC structure-function studies requires systematic methodological approaches:

By implementing these methodological safeguards, researchers can more confidently interpret contradictory results and build a more robust understanding of frdC structure and function.

How does the structure of frdC influence its interaction with other components of the fumarate reductase complex?

The structure of frdC plays a critical role in assembling a functional fumarate reductase complex:

  • Membrane anchoring function:

    • FrdC contains transmembrane segments that anchor the catalytic subunits (FrdA and FrdB) to the membrane

    • Both FrdC and FrdD are required for membrane association of fumarate reductase

  • Quinone interaction domains:

    • FrdC contributes to the oxidation of reduced quinone analogues

    • Specific residues likely form a quinone binding site within the membrane

  • Complex assembly requirements:

    • Separation of the DNA coding for FrdC and FrdD affects the ability of fumarate reductase to assemble into a functional complex

    • This suggests specific structural interactions between these subunits

  • Methodological approaches for studying these interactions:

    • Co-immunoprecipitation to identify binding partners

    • Cross-linking studies to map interaction interfaces

    • Mutagenesis of specific residues to identify functional domains

    • Blue native PAGE to analyze intact protein complexes

  • Structure-guided protein engineering:

    • Understanding the structure-function relationship can guide rational modifications

    • Target transmembrane domains for improved membrane insertion

    • Modify quinone-interacting regions to alter electron transfer properties

The current understanding of frdC structure-function relationships is still evolving, and further research combining structural biology with functional studies will continue to illuminate the precise mechanisms by which this protein contributes to fumarate reductase activity.

What are the considerations for optimizing recombinant protein yield when expressing frdC?

Optimizing recombinant frdC expression requires careful consideration of several factors:

  • Expression system selection:

    • Multiple expression systems are available for recombinant protein production:

      • E. coli-based systems (most common)

      • Yeast expression systems

      • Baculovirus-infected insect cells

      • Mammalian cell expression

  • Strain engineering approaches:

    • Studies have demonstrated that flagella regulation impacts recombinant protein production:

      • Deletion of flhC (a master regulator of flagella assembly) in appropriate genetic backgrounds can improve recombinant protein yields

      • High-yield production of recombinant protein has been achieved with reduced flagella formation

      • The recombinant enhanced green fluorescent protein yield per glucose consumption increased 1.81-fold in a flhC mutant strain

  • Metabolic considerations:

    • Metabolic burden caused by genetic modifications can sometimes be resolved by recombinant protein production

    • Introduction of a high copy number plasmid or overexpression of recombinant protein can restore growth rate without increasing glucose consumption in certain engineered strains

  • Growth conditions optimization:

    • For membrane proteins like frdC, lower induction temperatures often improve folding

    • Anaerobic conditions may be beneficial for expressing proteins normally induced under anaerobic conditions

    • Glucose availability affects fumarate to succinate conversion

  • Protein solubilization and purification:

    • Membrane proteins require appropriate detergents for solubilization

    • Affinity tags can facilitate purification but may affect protein function

    • Consider using biotinylation techniques like the AviTag-BirA technology

By systematically addressing these considerations, researchers can significantly improve the yield and quality of recombinant frdC for structural and functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.