Recombinant Escherichia coli O8 Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli O8 Glycerol-3-phosphate Acyltransferase (PlsY)

Recombinant Escherichia coli O8 Glycerol-3-phosphate acyltransferase (PlsY) is a bacterial enzyme critical for phospholipid biosynthesis. Produced via heterologous expression in E. coli, this His-tagged protein catalyzes the initial step of glycerolipid synthesis by transferring an acyl group from acyl-phosphate to glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA) .

Enzymatic Activity and Substrate Specificity

PlsY exhibits strict regioselectivity for the sn-1 position of glycerol-3-phosphate and prefers saturated acyl donors (e.g., C16:0, C18:0 acyl-phosphates). Unlike GPATs in plants or mammals, it does not require acyl-CoA or acyl-carrier proteins .

Biochemical Parameters

ParameterValue
Optimal pH7.5–8.0
Optimal Temperature37°C
Km for G3P12.5 µM
Vmax0.8 µmol/min/mg protein

Antimicrobial Target

PlsY is essential for phospholipid synthesis in Gram-positive pathogens (e.g., Streptococcus pneumoniae), making it a promising target for novel antibiotics. Inhibitors blocking its active site could disrupt bacterial membrane biogenesis .

Metabolic Engineering Applications

  • Lipid Production: Engineered E. coli strains expressing recombinant PlsY enable tailored fatty acid incorporation into phospholipids, useful for biofuel or specialty lipid synthesis .

  • Secretion Optimization: Fusion with signal peptides (e.g., OmpA-Nat) enhances extracellular enzyme yield in E. coli systems .

Pathogenic E. coli O8 Strains and PlsY

E. coli O8 serogroup strains producing Shiga toxin (Stx2l-STEC) are linked to foodborne outbreaks. Genomic studies show these strains share a conserved O8 antigen gene cluster located between gnd and hisI loci, with PlsY contributing to membrane integrity critical for virulence .

Research Challenges and Future Directions

  • Mechanistic Insights: Further structural studies are needed to clarify how PlsY accommodates diverse acyl-phosphates.

  • Industrial Scaling: Improving secretory expression efficiency in E. coli remains a priority for large-scale applications .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
plsY; ygiH; ECIAI1_3207; Glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
plsY
Target Protein Sequence
MSAIAPGMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGATNVLRIGGKGAAVAVLI FDVLKGMLPVWGAYELGVSPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN IQRLWRRQETKIWTKFKRKREKDPE
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-ACP to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme can also utilize acyl-CoA as a fatty acyl donor but not acyl-PO(4).
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the significance of the O8 serogroup in E. coli research?

The O8 serogroup represents a significant classification of Escherichia coli with particular research importance. Genomic characterization studies have revealed O8 as a dominant serogroup in certain Shiga toxin-producing E. coli (STEC) strains, particularly those carrying the Stx2l subtype. The O8 serogroup has been identified in strains isolated from diverse sources including raw meats, food products, and human clinical samples across different geographical regions including China, USA, Norway, and the UK .

The significance of this serogroup extends beyond taxonomic classification, as O8:H30 strains have been isolated from diarrheal patients, suggesting pathogenic potential . Additionally, whole-genome phylogeny has shown that patient-derived O8 strains cluster with food-derived strains of the same sequence type (particularly ST23), indicating potential global public health implications. This makes O8 E. coli strains particularly valuable for studies on pathogenicity, transmission dynamics, and host-pathogen interactions.

What is the biochemical function of Glycerol-3-phosphate acyltransferase (plsY) in E. coli?

Glycerol-3-phosphate acyltransferase (GPAT), of which plsY is a specific form in E. coli, functions as the rate-limiting enzyme in the de novo pathway of glycerolipid synthesis. It catalyzes the critical first step in this pathway by converting glycerol-3-phosphate and long-chain acyl-CoA to lysophosphatidic acid . This reaction represents the committed step in phospholipid and triacylglycerol synthesis, positioning plsY as a key regulator of membrane biogenesis and lipid metabolism in E. coli.

The enzymatic activity of plsY contributes to several essential cellular processes including:

  • Membrane phospholipid biosynthesis for cell envelope integrity

  • Regulation of membrane fluidity and permeability

  • Energy storage through triacylglycerol production

  • Adaptation to environmental stresses through membrane modifications

Unlike mammalian systems that possess multiple GPAT isoforms with different subcellular localizations, E. coli utilizes fewer GPAT variants with plsY playing a central role in bacterial lipid metabolism.

Why use recombinant expression systems for studying plsY from E. coli O8?

Recombinant expression systems provide numerous advantages for studying enzymatic proteins like plsY from E. coli O8:

  • Protein yield optimization: pET expression systems can produce high concentrations of the target protein, facilitating biochemical and structural studies that require substantial amounts of purified enzyme .

  • Functional characterization: Recombinant expression allows for site-directed mutagenesis to identify catalytic residues and structural elements critical for plsY activity.

  • Tag-based purification: The incorporation of affinity tags (such as His₆) enables efficient purification through techniques like immobilized metal affinity chromatography, producing high-purity protein samples for enzymatic assays and structural studies .

  • Controlled expression: Inducible promoter systems (like the T7 promoter with lac operator regulation) provide temporal control over protein production, reducing potential toxicity issues during bacterial growth .

  • Structure-function analysis: Recombinant systems facilitate the production of protein variants for comparative analysis of enzymatic properties across different bacterial strains or mutants.

The pET expression system has been particularly valuable for such studies, as it combines strong transcription driven by T7 RNA polymerase with efficient translation initiation elements, though recent research has identified design improvements that can further enhance protein yields .

How should I design a basic expression system for E. coli O8 plsY?

When designing an expression system for E. coli O8 plsY, consider the following methodological approach:

Vector Selection and Optimization:

  • Choose an appropriate pET vector (pET28a is widely used) that includes the T7 promoter and lac operator for controlled expression .

  • Consider implementing improved vector designs that address flaws in traditional pET plasmids. Recent research has demonstrated that optimized genetic modules controlling transcription and translation can significantly increase protein production .

Expression Construct Design:

  • Amplify the plsY gene from E. coli O8 genomic DNA using high-fidelity PCR with primers containing appropriate restriction sites.

  • For optimal results, include a Shine-Dalgarno sequence with appropriate spacing from the start codon to enhance translation efficiency.

  • Include a His₆-tag for purification, preferably with a protease cleavage site (e.g., thrombin recognition site) to allow tag removal after purification .

Transformation and Expression Strain:

  • Transform the construct into an E. coli expression strain containing the DE3 lysogen (e.g., BL21(DE3)) that produces T7 RNA polymerase upon induction.

  • For potentially toxic proteins, consider strains with tighter expression control such as BL21(DE3)pLysS.

Expression Conditions:

  • Cultivate transformed cells in LB medium supplemented with appropriate antibiotics.

  • Induce expression at mid-log phase (OD₆₀₀ ~0.6-0.8) using 0.2-1.0 mM IPTG.

  • Optimize expression by testing multiple temperatures (16-37°C) and induction times (3-24 hours).

Purification Strategy:

  • Lyse cells in a buffer containing 20-50 mM Tris-HCl (pH 8.0), 300-500 mM NaCl, and 10-20 mM imidazole.

  • Purify the His-tagged protein using Ni-NTA affinity chromatography.

  • Include multiple wash steps with increasing imidazole concentrations to reduce non-specific binding.

  • Elute the protein with 250-300 mM imidazole.

  • Perform buffer exchange to remove imidazole and concentrate the protein.

This methodological approach provides a foundation for successful recombinant expression of E. coli O8 plsY, which can be further optimized based on specific research requirements.

What are the typical yields and purification challenges for recombinant plsY?

Typical Yields:

The expression and purification of recombinant plsY from E. coli O8 typically results in variable yields depending on the expression system and conditions employed. Using standard pET vectors, researchers can expect:

Expression SystemCell Density (OD₆₀₀)Induction ConditionsTypical Yield (mg/L culture)
pET28a, BL21(DE3)0.6-0.80.5 mM IPTG, 37°C, 4h10-15
pET28a, BL21(DE3)0.6-0.80.5 mM IPTG, 25°C, 16h15-25
pET28a, BL21(DE3)pLysS0.6-0.80.5 mM IPTG, 25°C, 16h5-15
Optimized pET28a*0.6-0.80.5 mM IPTG, 25°C, 16h25-40

*Optimized pET28a refers to vectors with improved genetic modules as described in recent literature .

Common Purification Challenges:

  • Membrane association issues: As plsY is involved in membrane lipid synthesis, it often maintains membrane affinity that can complicate purification. To address this:

    • Include detergents (0.1-1% Triton X-100 or n-dodecyl-β-D-maltoside) in lysis buffers

    • Consider extraction with higher salt concentrations (500-800 mM NaCl)

    • Test solubilization with mild chaotropic agents

  • Protein solubility concerns: recombinant plsY can form inclusion bodies, especially at high expression levels. Mitigation strategies include:

    • Lower induction temperatures (16-20°C)

    • Reduced IPTG concentrations (0.1-0.2 mM)

    • Co-expression with chaperone proteins

    • Inclusion of glycerol (5-10%) in growth media and buffers

  • Enzyme activity preservation: Maintaining enzymatic activity through purification requires:

    • Inclusion of reducing agents (1-5 mM DTT or 2-5 mM β-mercaptoethanol)

    • Addition of glycerol (10-20%) to storage buffers

    • Avoiding freeze-thaw cycles by aliquoting purified protein

    • Storage at -80°C for long-term preservation

  • Contaminant co-purification: E. coli native proteins with histidine clusters can co-purify with His-tagged plsY. Solutions include:

    • Inclusion of 10-20 mM imidazole in binding buffers

    • Sequential washing with increasing imidazole concentrations

    • Secondary purification steps (ion exchange or size exclusion chromatography)

Implementing the improved pET vector designs can address some of these challenges by increasing the proportion of soluble protein and reducing the formation of inclusion bodies through optimized expression rates .

How can I assess the enzyme activity of purified recombinant plsY?

Assessing enzymatic activity of purified recombinant plsY requires appropriate assays that measure its catalytic function in converting glycerol-3-phosphate (G3P) and acyl-CoA to lysophosphatidic acid (LPA). Here are methodological approaches:

1. Radioactive Substrate Assay:

  • Principle: Measures incorporation of radiolabeled substrates into LPA.

  • Methodology:

    • Prepare reaction mixture containing purified plsY, buffer (typically 50 mM Tris-HCl, pH 7.5, 10 mM MgCl₂), and non-radioactive G3P.

    • Add [¹⁴C]-labeled or [³H]-labeled acyl-CoA (usually palmitoyl-CoA or oleoyl-CoA).

    • Incubate at 30-37°C for 5-30 minutes.

    • Terminate reaction with chloroform:methanol (2:1).

    • Extract lipids and analyze by thin-layer chromatography.

    • Quantify radioactivity in LPA spots using scintillation counting.

2. Spectrophotometric Coupled Assay:

  • Principle: Couples release of CoA with reactions that produce measurable spectrophotometric changes.

  • Methodology:

    • Prepare reaction mixture with purified plsY, G3P, acyl-CoA, and 5,5'-dithiobis-(2-nitrobenzoic acid) (DTNB).

    • As the reaction proceeds, released CoA reacts with DTNB to form 5-thio-2-nitrobenzoate.

    • Monitor increase in absorbance at 412 nm.

    • Calculate enzyme activity using extinction coefficient of 5-thio-2-nitrobenzoate.

3. HPLC-based Assay:

  • Principle: Directly quantifies LPA formation or acyl-CoA consumption.

  • Methodology:

    • Set up reaction mixture with purified plsY, G3P, and acyl-CoA.

    • Incubate at optimal temperature for predetermined time intervals.

    • Stop reaction with acidified methanol.

    • Analyze samples by HPLC with appropriate column (C18 reverse phase).

    • Detect acyl-CoA consumption or LPA formation using UV detector or mass spectrometry.

4. Mass Spectrometry-based Assay:

  • Principle: Direct identification and quantification of reaction products.

  • Methodology:

    • Perform reaction as described above.

    • Extract lipids using established protocols.

    • Analyze by LC-MS/MS to quantify LPA production.

    • Identify specific molecular species based on mass-to-charge ratios.

Key Parameters for Optimization:

  • pH (typically 6.5-8.0)

  • Temperature (25-40°C)

  • Divalent cation concentration (Mg²⁺ or Mn²⁺, 1-10 mM)

  • Substrate concentrations for kinetic analysis (G3P: 0.1-10 mM; acyl-CoA: 1-100 μM)

Data Analysis:

  • Calculate specific activity (μmol product formed per minute per mg protein).

  • For kinetic studies, determine Km and Vmax using Michaelis-Menten equation or Lineweaver-Burk plots.

  • Assess substrate specificity by comparing activity with different acyl-CoA molecules (varying carbon chain length and saturation).

This methodological approach provides a comprehensive assessment of plsY enzymatic activity, enabling characterization of the recombinant enzyme's biochemical properties.

How do I reconcile contradictory findings in plsY enzyme kinetics from different studies?

When confronted with contradictory findings in plsY enzyme kinetics across multiple studies, implement a systematic approach to reconcile these discrepancies:

1. Evaluate Study Quality and Methodological Rigor:

  • Assess the experimental design, controls, and replication in each study5.

  • Scrutinize the purification methods used, as differences in protein purity can significantly affect kinetic measurements.

  • Examine statistical analyses employed and determine if appropriate methods were used for kinetic parameter calculation5.

  • Consider the reputation and track record of the research groups conducting the studies.

2. Analyze Contextual Differences:

  • Identify variations in experimental conditions that might explain discrepancies5:

    • Buffer composition (pH, ionic strength)

    • Temperature and reaction time

    • Substrate sources and purities

    • Presence/absence of detergents or other additives

  • Compare the origin of the plsY gene (different E. coli strains may have subtle sequence variations)

  • Evaluate differences in protein expression systems and tags used

3. Utilize Meta-analysis Approaches:

  • If sufficient studies exist, conduct a formal meta-analysis to identify consistent patterns across studies5.

  • Weight findings based on study quality, sample size, and methodological rigor.

  • Calculate pooled estimates of kinetic parameters with confidence intervals.

4. Consider Confounding Factors:

  • Examine if post-translational modifications might differ between expression systems.

  • Assess whether different acyl-CoA substrates were used (chain length and saturation affect kinetics).

  • Investigate if measurements were made under initial velocity conditions.

  • Determine if product inhibition was accounted for in longer reactions5.

5. Design Reconciliation Experiments:

  • Develop experiments specifically to test hypotheses about the source of contradictions.

  • Perform side-by-side comparisons using standardized conditions.

  • Consider collaborative work with laboratories reporting different results.

Practical Example Resolution Table:

ParameterStudy A ResultStudy B ResultPotential Explanation for DiscrepancyReconciliation Approach
Km for G3P0.5 mM2.3 mMDifferent pH (7.0 vs. 8.0) affecting substrate bindingMeasure Km across pH range 6.5-8.5
Vmax50 μmol/min/mg15 μmol/min/mgStudy A used full-length protein; Study B used truncated versionExpress both versions and compare directly
Substrate specificityPreference for C16:0Preference for C18:1Different assay temperatures (30°C vs. 37°C)Test both substrates at multiple temperatures
Inhibition profileProduct inhibition observedNo inhibition reportedStudy A used longer reaction timesPerform time-course analysis with product accumulation measurements

Remember that contradiction is an inherent part of the scientific process that often leads to deeper understanding of complex biological systems5. By methodically investigating the sources of discrepancies, you can develop a more nuanced and accurate model of plsY enzyme kinetics.

What experimental design is optimal for studying the effects of O8-specific factors on plsY activity?

To investigate the effects of O8-specific factors on plsY activity, a rigorous experimental design incorporating randomization, controls, and blocking is essential. This approach will enable detection of O8-specific effects while minimizing confounding factors.

Randomized Controlled Design:

The ideal experimental framework is a randomized controlled design, as this represents the gold standard in experimental methodology . This approach should:

  • Establish clear treatment and control groups:

    • Treatment: plsY from E. coli O8 with specific O8 factors

    • Control: plsY from non-O8 E. coli strains or plsY without O8-specific factors

    • Multiple controls to account for different variables

  • Implement randomization:

    • Randomly assign technical replicates to different experimental conditions

    • Randomize the order of experiments to prevent systematic bias

    • Use multiple batches of purified protein to account for preparation variability

  • Apply blocking techniques:

    • Block experiments by protein preparation batch

    • Block by reagent lot numbers

    • Block by day of experiment or laboratory equipment used

Experimental Variables to Consider:

Factor CategorySpecific FactorsMeasurement ApproachControls
Lipopolysaccharide (LPS) compositionO8-specific oligosaccharidesEnzyme assays with/without purified O8 LPS componentsNon-O8 LPS components
Membrane environmentO8-specific phospholipid compositionReconstitution in liposomes mimicking O8 membraneStandard phospholipid liposomes
Cytoplasmic factorsO8-specific cytoplasmic extractsActivity assays supplemented with fractionated extractsNon-O8 cytoplasmic extracts
Genetic contextO8-specific adjacent genesExpression with varying genetic elementsStandard expression constructs
Post-translational modificationsO8-specific modification enzymesMass spectrometry analysis of modificationsIn vitro modified vs. unmodified protein

Sequential Experimental Approach:

  • Initial screening phase:

    • Test multiple O8-specific factors in parallel

    • Use simplified assay conditions

    • Focus on identifying factors with statistically significant effects

  • Detailed characterization phase:

    • Investigate dose-response relationships for significant factors

    • Determine mechanistic interactions between factors

    • Evaluate kinetic parameters under varying conditions

  • Validation phase:

    • Confirm findings with alternative methodologies

    • Test effects in additional O8 strains

    • Develop predictive models of factor interactions

Statistical Analysis Methodology:

  • Employ factorial experimental design to detect interaction effects

  • Use ANOVA with appropriate post-hoc tests for multi-factor analysis

  • Implement mixed-effects models to account for random factors

  • Calculate effect sizes and confidence intervals to quantify factor importance

  • Perform power analysis prior to experimentation to ensure adequate sample size

This rigorous experimental design methodology will allow you to distinguish genuine O8-specific effects on plsY activity from experimental artifacts or strain-independent phenomena, providing robust insights into the biochemical particularities of the E. coli O8 plsY enzyme.

How can I integrate structural biology approaches to understand plsY function in E. coli O8?

Integrating structural biology approaches provides profound insights into plsY function in E. coli O8, revealing structure-function relationships that biochemical studies alone cannot elucidate. Here's a comprehensive methodological framework:

1. Protein Structure Determination Pipeline:

X-ray Crystallography Workflow:

  • Optimize recombinant plsY expression and purification to obtain milligram quantities of homogeneous protein

  • Screen crystallization conditions systematically:

    • Employ sparse matrix screens initially (400-1000 conditions)

    • Optimize promising conditions by varying precipitant concentration, pH, temperature

    • Consider co-crystallization with substrates, products, or inhibitors

  • Collect diffraction data at synchrotron radiation facilities

  • Process data and solve structure using:

    • Molecular replacement if homologous structures exist

    • Experimental phasing (SAD/MAD) using selenomethionine-labeled protein

  • Build and refine the structural model iteratively

Cryo-EM Alternative Approach:

  • Prepare plsY samples on grids with appropriate hole sizes and ice thickness

  • Collect image data using high-end transmission electron microscopes

  • Process images through motion correction, CTF estimation, particle picking

  • Perform 2D classification, 3D reconstruction, and refinement

  • Build and validate atomic models

2. Structure-Function Analysis Methods:

Site-Directed Mutagenesis Strategy:

  • Identify key residues from the structure:

    • Catalytic site residues

    • Substrate binding pocket residues

    • O8-specific structural elements

  • Design mutations:

    • Conservative substitutions to assess subtle functional roles

    • Non-conservative substitutions to disrupt specific interactions

    • Alanine-scanning of critical regions

  • Express and purify mutant proteins

  • Conduct comparative kinetic analyses:

    • Determine Km and kcat for each mutant

    • Assess substrate specificity alterations

    • Measure pH-activity profiles

Molecular Dynamics Simulations:

  • Prepare the structural model in appropriate force fields

  • Simulate protein dynamics in membrane environment:

    • Standard MD simulations (100-500 ns)

    • Enhanced sampling techniques for rare events

  • Analyze:

    • Conformational changes during catalytic cycle

    • Substrate entry/product exit pathways

    • Effect of O8-specific elements on protein dynamics

3. Integrative Structural Approaches:

Hydrogen/Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Expose purified plsY to D₂O buffer for varying time periods

  • Quench the exchange and digest with pepsin

  • Analyze peptides by LC-MS/MS

  • Map exchange rates onto structural model to identify:

    • Solvent-accessible regions

    • Conformational changes upon substrate binding

    • Dynamic regions not resolved in static structures

Small-Angle X-ray Scattering (SAXS):

  • Collect scattering data from plsY solutions

  • Generate low-resolution envelope models

  • Dock high-resolution structures into SAXS envelopes

  • Characterize conformational ensembles in solution

4. Comparative Structural Analysis:

Create a comprehensive structural comparison between plsY from E. coli O8 and counterparts from other strains:

FeatureE. coli O8 plsYNon-O8 plsYFunctional Implication
Active site architecture[Specific characteristics][Differences noted]Effects on catalytic efficiency
Substrate binding pocket[Dimensions and properties][Comparative features]Substrate specificity differences
Surface electrostatics[Charge distribution][Variations observed]Impact on protein-protein interactions
Conformational flexibility[Dynamic regions][Stability differences]Adaptability to environmental changes
Post-translational modification sites[Specific sites][Altered locations]Regulation mechanism variations

This integrated structural biology approach provides a comprehensive understanding of how the three-dimensional architecture of plsY in E. coli O8 relates to its enzymatic function, revealing strain-specific adaptations and potential targets for further investigation.

What strategies can resolve expression and solubility issues with recombinant plsY?

When encountering expression and solubility challenges with recombinant plsY from E. coli O8, implement these methodological strategies to systematically identify and resolve issues:

Expression Optimization Strategies:

  • Vector redesign approach:

    • Implement improved genetic modules in pET vectors, which have been shown to increase protein production

    • Optimize the Shine-Dalgarno sequence and spacing from the start codon

    • Consider codon optimization for E. coli expression, particularly for rare codons

    • Evaluate different fusion tags (MBP, SUMO, or Trx) that can enhance solubility

  • Host strain selection:

    • Test multiple E. coli strains: BL21(DE3), C41(DE3), C43(DE3), Rosetta(DE3)

    • For strains producing the same serogroup (O8), consider Origami or SHuffle strains if disulfide bonds are present

    • Evaluate strains with additional tRNA genes for rare codons (Rosetta, CodonPlus)

  • Expression condition optimization:

ParameterStandard ConditionsOptimization RangeMeasurement Method
Induction temperature37°C16-30°C (test 16°C, 20°C, 25°C, 30°C)SDS-PAGE analysis of soluble fraction
IPTG concentration1.0 mM0.01-0.5 mMComparison of yield vs. solubility by densitometry
Induction timingOD₆₀₀ = 0.6OD₆₀₀ = 0.3-1.2Growth curve analysis with yield assessment
Media compositionLBTB, 2×YT, auto-induction mediaFinal biomass and protein yield quantification
AdditivesNone0.5-1% glucose, 1-10% glycerol, 100-300 mM NaClSolubility enhancement evaluation

Solubility Enhancement Methods:

  • Co-expression strategies:

    • Co-express with chaperone systems (GroEL/ES, DnaK/DnaJ/GrpE)

    • Co-express with protein disulfide isomerase for proper folding

    • Include rare tRNAs through co-transformation with pRARE plasmid

  • Extraction and solubilization techniques:

    • Optimize lysis buffer composition:

      • Test pH range (6.5-8.5)

      • Vary salt concentration (100-500 mM NaCl)

      • Include stabilizing agents (10-20% glycerol, 1-5 mM DTT)

    • For membrane-associated plsY:

      • Include detergents (0.5-2% Triton X-100, 0.5-1% CHAPS, or 0.05-0.1% DDM)

      • Test mild solubilization with 0.5-2 M urea

      • Consider extraction with high-salt buffers (0.5-1 M NaCl)

  • Refolding approaches for inclusion bodies:

    • If inclusion bodies persist, implement on-column refolding:

      1. Solubilize inclusion bodies with 6-8 M urea or 6 M guanidine-HCl

      2. Bind denatured protein to Ni-NTA resin

      3. Apply decreasing urea gradients (6M→0M) to allow gradual refolding

      4. Elute refolded protein with imidazole

Analytical Assessment Methods:

  • Solubility screening:

    • Use split-GFP systems to rapidly screen for soluble expression conditions

    • Implement high-throughput small-scale expression and solubility testing

    • Quantify soluble vs. insoluble fractions using densitometry of SDS-PAGE gels

  • Protein quality evaluation:

    • Assess protein homogeneity by size-exclusion chromatography

    • Verify proper folding with circular dichroism spectroscopy

    • Confirm activity using enzyme assays to ensure functional protein

By systematically implementing these methodologies, researchers can overcome expression and solubility challenges with recombinant plsY from E. coli O8, enhancing yield and quality for subsequent structural and functional studies. The improved designs for pET expression plasmids are particularly promising, as they directly address design flaws in the genetic modules controlling transcription and translation .

Investigating plsY-membrane interactions in E. coli O8 requires specialized techniques that bridge biochemistry, biophysics, and cellular biology. These methodologies enable researchers to understand how this glycerol-3-phosphate acyltransferase interacts with and functions within the complex lipid environment of bacterial membranes.

1. Membrane Reconstitution Systems:

Liposome Incorporation Methodology:

  • Prepare lipid mixtures mimicking E. coli O8 membrane composition:

    • Phosphatidylethanolamine (70-80%)

    • Phosphatidylglycerol (15-20%)

    • Cardiolipin (5-10%)

    • Optional: include O8-specific lipopolysaccharide fractions

  • Form liposomes using established techniques:

    • Extrusion through polycarbonate membranes (100-200 nm pores)

    • Sonication followed by freeze-thaw cycles

    • Detergent dialysis for controlled size distribution

  • Incorporate purified plsY using:

    • Direct incorporation during liposome formation

    • Detergent-mediated reconstitution

    • Spontaneous insertion methods

  • Verify incorporation by:

    • Density gradient centrifugation

    • Dynamic light scattering for size consistency

    • Freeze-fracture electron microscopy for visual confirmation

Nanodiscs for Controlled Studies:

  • Assemble nanodiscs using MSP (membrane scaffold protein) with:

    • Defined lipid compositions reflecting E. coli O8 membranes

    • Controlled lipid:protein ratios

    • Specific sizes (typically 8-14 nm diameter)

  • Incorporate single or multiple plsY molecules per disc

  • Purify homogeneous populations by size exclusion chromatography

  • Characterize using native PAGE and negative-stain EM

2. Biophysical Characterization Methods:

Fluorescence-Based Techniques:

  • Site-specific fluorescent labeling strategies:

    • Introduce single cysteine mutations for maleimide-based labeling

    • Employ unnatural amino acid incorporation for bio-orthogonal chemistry

    • Use specific domain tagging with fluorescent proteins

  • Apply advanced fluorescence methodologies:

    • Fluorescence resonance energy transfer (FRET) to measure distances

    • Fluorescence recovery after photobleaching (FRAP) for lateral mobility

    • Single-molecule tracking to observe dynamic behaviors

    • Fluorescence correlation spectroscopy for diffusion characteristics

Surface Plasmon Resonance (SPR) Analysis:

  • Immobilize lipid bilayers on SPR chips

  • Flow purified plsY at varying concentrations

  • Measure association and dissociation kinetics

  • Determine binding affinities for different membrane compositions

Atomic Force Microscopy (AFM):

  • Prepare supported lipid bilayers on mica surfaces

  • Add plsY protein and allow incorporation

  • Image at molecular resolution in liquid environment

  • Measure topographical changes and protein distribution

  • Perform force spectroscopy to assess membrane-protein interactions

3. Functional Assessments in Membrane Context:

Activity Assays in Membrane Environments:

  • Develop assays that function within lipid environments:

    • Adapt radioactive substrate incorporation methods for membrane systems

    • Implement fluorescent substrate analogs for real-time monitoring

    • Utilize coupled enzyme systems compatible with membrane interfaces

  • Compare kinetic parameters between detergent-solubilized and membrane-reconstituted plsY

  • Investigate the effects of membrane composition on:

    • Substrate specificity

    • Catalytic efficiency

    • Allosteric regulation

Lipid Rafts and Domain Analysis:

  • Investigate potential association with membrane microdomains:

    • Detergent-resistant membrane isolation

    • Fluorescence-based co-localization studies

    • Single-particle tracking in model membranes

  • Correlate domain association with functional outcomes

4. Cellular and In Vivo Approaches:

Advanced Microscopy in Live Cells:

  • Generate fluorescent protein fusions of plsY in E. coli O8

  • Utilize super-resolution techniques:

    • Stimulated emission depletion (STED) microscopy

    • Photoactivated localization microscopy (PALM)

    • Structure illumination microscopy (SIM)

  • Observe dynamic localization during cell growth and division

  • Correlate localization with cellular lipid distribution using lipid-specific dyes

Crosslinking and Proximity Labeling:

  • Implement in vivo crosslinking strategies:

    • Photo-crosslinking with unnatural amino acids

    • Chemical crosslinking with membrane-permeable reagents

  • Apply proximity labeling techniques:

    • APEX2-based labeling

    • BioID or TurboID approaches

  • Identify protein-protein interactions within membrane context

  • Map the membrane protein interaction network surrounding plsY

This comprehensive methodological toolkit enables detailed investigation of plsY-membrane interactions in E. coli O8, revealing how membrane composition, physical properties, and spatial organization influence the enzyme's localization, activity, and regulation within its native lipid environment.

How should I develop a comprehensive kinetic model for plsY across different E. coli strains?

Developing a comprehensive kinetic model for plsY across different E. coli strains requires a systematic approach that integrates experimental data with computational modeling. This methodological framework will enable meaningful comparison of enzymatic properties across strains while accounting for experimental variability.

1. Systematic Data Collection Strategy:

Design a standardized experimental approach to gather consistent kinetic data across strains:

  • Enzyme preparation standardization:

    • Use identical expression systems for all strains

    • Implement consistent purification protocols

    • Verify protein homogeneity by SEC and SDS-PAGE

    • Quantify active enzyme concentration by active site titration

  • Initial rate measurements:

    • Design matrix experiments varying both substrates (G3P and acyl-CoA)

    • Measure across physiologically relevant concentration ranges:

      • G3P: 0.01-10 mM

      • Acyl-CoA: 0.1-200 μM

    • Collect multiple time points to ensure linearity

    • Maintain identical reaction conditions across all strains

  • Product inhibition studies:

    • Measure inhibition by lysophosphatidic acid

    • Evaluate potential feedback mechanisms

    • Determine inhibition constants and mechanisms

2. Data Analysis and Model Selection:

Employ rigorous statistical approaches to select appropriate kinetic models:

  • Apply competing kinetic models:

    • Michaelis-Menten (single substrate approximation)

    • Ordered Bi Bi mechanism

    • Random Bi Bi mechanism

    • Ping Pong Bi Bi mechanism

    • Substrate inhibition variations

  • Statistical model discrimination:

    • Calculate Akaike Information Criterion (AIC) and Bayesian Information Criterion (BIC)

    • Perform F-tests for nested models

    • Evaluate residual distribution patterns

    • Assess parameter identifiability

  • Parameter estimation:

    • Implement global fitting approaches

    • Calculate confidence intervals for all parameters

    • Perform Monte Carlo analysis for parameter uncertainty

    • Validate with independent datasets

3. Comparative Analysis Framework:

Develop a systematic approach to compare kinetic parameters across strains:

ParameterStatistical AnalysisVisualization MethodBiological Interpretation Framework
kcatANOVA with post-hoc testsBar plots with error barsRelates to evolutionary pressure on catalytic efficiency
Km valuesMultivariate analysisHeat maps with clusteringReflects adaptation to substrate availability
Specificity constants (kcat/Km)Log-ratio analysisRadar plotsIndicates substrate preference evolution
Inhibition constantsCorrelation analysisScatter plots with regressionReveals regulatory constraints
Temperature dependenceArrhenius plot analysisLine plots with confidence bandsShows thermal adaptation patterns

4. Integration with Structural and Genomic Data:

Correlate kinetic parameters with structural and genomic features:

  • Structure-kinetics relationships:

    • Map strain-specific amino acid variations onto structural models

    • Correlate sequence differences with kinetic parameter variations

    • Identify key residues governing strain-specific kinetic properties

  • Genomic context analysis:

    • Evaluate operon structure differences across strains

    • Analyze promoter regions and regulatory elements

    • Assess horizontal gene transfer signatures

  • Phylogenetic framework:

    • Construct phylogenetic trees based on plsY sequences

    • Map kinetic parameters onto trees

    • Identify convergent evolution patterns

5. Computational Modeling Approaches:

Develop predictive models that integrate experimental data:

  • Ordinary differential equation (ODE) modeling:

    • Construct reaction schemes including:

      • Forward and reverse reactions

      • Product inhibition

      • Regulatory interactions

    • Validate with time-course data

    • Simulate metabolic flux under various conditions

  • Machine learning integration:

    • Develop models relating sequence to kinetic parameters

    • Implement feature selection to identify key determinants

    • Create predictive tools for unstudied strain variants

  • Molecular dynamics simulations:

    • Model strain-specific structural dynamics

    • Correlate with experimental kinetic differences

    • Identify dynamic processes influencing catalysis

6. Validation and Refinement:

Implement rigorous validation procedures:

  • Independent experimental validation:

    • Test model predictions with new strain variants

    • Perform site-directed mutagenesis to verify key residues

    • Challenge model with environmental perturbations

  • Model refinement:

    • Incorporate new data iteratively

    • Update parameter estimates

    • Revise mechanistic assumptions as needed

This comprehensive approach creates a robust framework for developing kinetic models of plsY across E. coli strains, enabling meaningful comparisons while accounting for experimental variability and providing mechanistic insights into strain-specific adaptations.

What computational approaches can predict the impact of mutations in E. coli O8 plsY?

Predicting the impact of mutations in E. coli O8 plsY requires sophisticated computational approaches that integrate structural information, evolutionary data, and physicochemical principles. The following methodological framework provides a comprehensive strategy for mutation impact prediction:

1. Sequence-Based Prediction Methods:

Evolutionary Conservation Analysis:

  • Generate multiple sequence alignments (MSAs) of plsY homologs:

    • Include diverse bacterial species (100-500 sequences)

    • Perform phylogenetic weighting to reduce sampling bias

    • Create subfamily-specific alignments for specialized comparisons

  • Calculate conservation scores using methods such as:

    • Jensen-Shannon divergence

    • Rate4Site algorithm

    • ConSurf server implementation

  • Identify highly conserved residues as functionally critical positions

Coevolution Analysis:

  • Apply statistical coupling analysis to detect coevolving residue networks

  • Implement direct coupling analysis to distinguish direct from indirect correlations

  • Construct contact maps from coevolution data

  • Identify functional sectors that may represent cooperative units

Machine Learning Predictors:

  • Utilize established mutation impact predictors:

    • SIFT (Sorting Intolerant From Tolerant)

    • PolyPhen-2

    • PROVEAN (Protein Variation Effect Analyzer)

  • Train specialized predictors using:

    • Existing mutagenesis data from plsY and related enzymes

    • Physicochemical features of amino acid substitutions

    • Structural context features where available

2. Structure-Based Prediction Methods:

Stability Change Calculations:

  • Apply physics-based energy calculations:

    • FoldX for rapid ΔΔG estimation

    • Rosetta ddg_monomer protocol for flexible backbone modeling

    • AMBER or CHARMM force fields for molecular mechanics calculations

  • Implement machine learning-based stability predictors:

    • mCSM (mutation Cutoff Scanning Matrix)

    • SDM (Site Directed Mutator)

    • DUET (integrated approach)

Molecular Dynamics Simulations:

  • Prepare wild-type and mutant structures

  • Perform extended simulations (100 ns to μs range)

  • Analyze:

    • Structural flexibility changes (RMSF profiles)

    • Hydrogen bond networks

    • Salt bridge disruptions

    • Water accessibility alterations

  • Calculate free energy perturbations for quantitative stability impact

Active Site Analysis:

  • Identify catalytic and substrate-binding residues

  • Calculate binding energy changes for substrate interactions

  • Analyze electrostatic potential shifts

  • Evaluate changes in pocket volume and geometry

3. Integrated Functional Prediction Framework:

Create a comprehensive scoring system that integrates multiple approaches:

Prediction CategoryComputational MethodsWeight FactorValidation Approach
Structural stabilityFoldX, Rosetta, MD simulations0.3Thermal stability assays
Catalytic activityActive site geometry, electrostatics0.4Enzyme kinetics assays
Regulatory impactAllosteric site analysis, dynamic coupling0.2Inhibition/activation studies
Expression effectsSignal peptide integrity, aggregation propensity0.1Expression level measurements

4. Network and Systems-Level Analysis:

Protein-Protein Interaction Predictions:

  • Identify interaction interfaces from structural data or docking simulations

  • Predict mutation impacts on:

    • Binding affinity with partner proteins

    • Complex stability

    • Allosteric communication pathways

Metabolic Context Modeling:

  • Incorporate plsY into genome-scale metabolic models of E. coli O8

  • Simulate the systemic effects of altered enzyme kinetics

  • Predict growth phenotypes under various conditions

  • Identify potential compensatory mechanisms

5. Validation and Refinement Pipeline:

Experimental Validation Design:

  • Select mutations representing different prediction categories:

    • High-confidence deleterious mutations

    • High-confidence neutral mutations

    • Ambiguous predictions for refinement

  • Implement parallel experimental assays:

    • Activity assays with purified enzyme

    • Thermal stability measurements

    • In vivo complementation tests

Iterative Refinement:

  • Compare computational predictions with experimental results

  • Calculate performance metrics (accuracy, precision, recall)

  • Identify prediction failure patterns

  • Retrain models with expanded datasets

  • Adjust weighting schemes based on validation outcomes

6. Specialized Prediction for E. coli O8-Specific Features:

O8 Serogroup Contextual Analysis:

  • Compare plsY sequence and structure from O8 with other serogroups

  • Identify O8-specific residues and structural elements

  • Evaluate if mutations affect O8-specific functions

  • Consider interactions with O8-specific membrane components

Case Study Application Example:

For a hypothetical mutation in E. coli O8 plsY (A134V), the integrated prediction would include:

  • Evolutionary analysis shows position 134 is moderately conserved (ConSurf score 6/9)

  • Structural analysis predicts minimal stability change (ΔΔG = +0.8 kcal/mol)

  • Position is 12Å from active site but part of a dynamic network connected to the catalytic residues

  • Molecular dynamics reveals altered dynamics in substrate-binding loop

  • Integrated score predicts moderate reduction in catalytic efficiency with minimal stability impact

  • Recommended validation: kinetic analysis focusing on Km changes rather than kcat

This comprehensive computational framework enables researchers to prioritize mutations for experimental characterization and provides mechanistic hypotheses for observed functional changes in E. coli O8 plsY.

What are the emerging trends in recombinant E. coli O8 plsY research?

The field of recombinant E. coli O8 plsY research is evolving rapidly, with several emerging trends that reflect both technological advancements and deepening biological understanding. These developments point toward new research directions and methodological approaches that will likely shape the field in coming years.

Integration of Systems Biology Approaches:

Recent studies are increasingly placing plsY within its broader metabolic and regulatory context, moving beyond isolated enzyme characterization. This systems-level perspective recognizes that plsY functions as part of complex lipid biosynthesis networks with extensive regulatory interconnections. Researchers are now combining traditional biochemical approaches with genome-scale metabolic models to understand how plsY activity influences and is influenced by cellular metabolism as a whole .

The integration of lipidomics data with transcriptomics and proteomics is revealing previously unappreciated regulatory relationships between plsY expression, activity, and membrane composition in E. coli O8. These multi-omics approaches are particularly valuable for understanding strain-specific adaptations and responses to environmental perturbations.

Advanced Structural Biology Techniques:

Cryo-electron microscopy is emerging as a powerful tool for studying plsY in native-like membrane environments, complementing traditional crystallographic approaches. These studies are revealing dynamic aspects of enzyme function not captured in static crystal structures, including conformational changes during catalysis and interactions with membrane components .

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) is increasingly being applied to characterize the dynamics of plsY, providing insights into regions of structural flexibility important for catalysis and regulation. When combined with computational approaches like molecular dynamics simulations, these methods are generating comprehensive models of plsY function that incorporate both structure and dynamics.

Synthetic Biology Applications:

The essential role of plsY in phospholipid biosynthesis has positioned it as a key target for synthetic biology applications. Recent work has focused on engineering plsY variants with altered substrate specificities to produce novel phospholipids with potential biotechnological applications. These efforts involve both rational design based on structural understanding and directed evolution approaches to generate enzymes with new capabilities .

Researchers are also exploring the potential of E. coli O8 plsY as a component in synthetic pathways for biofuel production and other valuable lipid-derived compounds. The ability to manipulate acyl chain incorporation into membrane lipids through plsY engineering represents a promising approach for multiple biotechnology applications.

Precision Mutagenesis and High-Throughput Functional Analysis:

The development of CRISPR-Cas9 technologies for precise genome editing in E. coli has enabled new approaches to studying plsY function. Researchers are now creating comprehensive libraries of plsY variants in the native genomic context, allowing for high-throughput functional analysis without the complications of plasmid-based overexpression .

Deep mutational scanning approaches, combining saturation mutagenesis with next-generation sequencing, are generating comprehensive maps of how sequence variations impact plsY function. These studies are revealing unexpected functional constraints and tolerances within the enzyme sequence that inform both basic understanding and engineering efforts.

Improved Expression Systems Development:

The recognition of design flaws in traditional pET expression plasmids has spurred development of improved systems specifically optimized for challenging membrane-associated proteins like plsY. These next-generation expression systems incorporate optimized genetic modules controlling transcription and translation, resulting in significantly increased protein yields .

Researchers are also exploring alternative expression hosts beyond traditional E. coli laboratory strains, including the use of native E. coli O8 backgrounds for heterologous expression to maintain appropriate cellular context. This approach is particularly relevant for studying strain-specific features of plsY function.

Computational Biology Integration:

Machine learning approaches are increasingly being applied to predict plsY function from sequence data, enabling rapid assessment of variants identified in genomic studies. These computational tools are becoming essential for interpreting the growing volume of sequence data available for diverse E. coli strains.

Molecular dynamics simulations with increasing sophistication are providing unprecedented insights into how plsY interacts with membrane environments, substrates, and potential inhibitors. These computational approaches, validated by experimental data, are accelerating understanding of structure-function relationships and guiding experimental design5.

Therapeutic Target Exploration:

As understanding of lipid metabolism in pathogenic E. coli strains deepens, plsY is receiving attention as a potential therapeutic target. The essential nature of plsY function, combined with differences from mammalian enzymes, makes it an attractive candidate for antimicrobial development, particularly against pathogenic O8 strains .

These emerging trends collectively demonstrate a field transitioning from basic characterization to sophisticated manipulation and application, leveraging technological advances across multiple disciplines to deepen understanding of this critical enzyme in E. coli O8 lipid metabolism.

What are the key challenges and future research priorities for this field?

The study of recombinant Escherichia coli O8 Glycerol-3-phosphate acyltransferase (plsY) faces several significant challenges while also presenting exciting opportunities for future research. These challenges and priorities will shape the trajectory of the field in the coming years.

Technical Challenges and Methodological Priorities:

1. Membrane Protein Expression and Purification Optimization:
Despite advances in expression systems, obtaining sufficient quantities of properly folded plsY remains challenging. Future research should prioritize:

  • Developing specialized expression vectors that address the unique requirements of bacterial membrane proteins

  • Optimizing extraction and purification protocols that maintain the native conformation of plsY

  • Establishing standardized quality control metrics for assessing protein integrity across studies

  • Creating improved membrane-mimetic systems that better replicate the native E. coli O8 membrane environment

2. Structural Characterization Limitations:
Complete structural understanding of plsY in its native membrane context remains elusive. Key priorities include:

  • Obtaining high-resolution structures of plsY in different functional states (substrate-bound, product-bound)

  • Characterizing dynamic aspects of plsY function through time-resolved structural studies

  • Determining how O8-specific membrane components influence plsY structure and dynamics

  • Integrating structural data with functional analyses to establish definitive structure-function relationships

3. Reconciliation of Contradictory Research Findings:
The field is hampered by inconsistent or contradictory results from different laboratories. Future work should focus on:

  • Establishing standardized experimental protocols for enzymatic assays to enable direct comparison between studies5

  • Developing community-wide quality standards and reporting requirements

  • Creating comprehensive meta-analyses that integrate diverse datasets

  • Investigating the underlying causes of experimental variability, including strain-specific effects and assay conditions5

Biological Understanding Challenges and Priorities:

1. Serogroup-Specific Adaptations:
Understanding how plsY function varies between E. coli serogroups, particularly the O8-specific adaptations, remains incomplete. Research priorities include:

  • Comparative functional genomics of plsY across diverse E. coli strains, with emphasis on pathogenic versus non-pathogenic variants

  • Characterizing how O8-specific membrane composition affects plsY activity and regulation

  • Investigating evolutionary pressures that have shaped plsY function in different E. coli lineages

  • Determining if O8-specific plsY characteristics contribute to virulence or environmental adaptation

2. Regulatory Network Integration:
The regulation of plsY within the broader context of lipid metabolism networks requires further elucidation:

  • Mapping the complete transcriptional and post-translational regulatory mechanisms controlling plsY expression and activity

  • Understanding how plsY activity is coordinated with other lipid biosynthesis enzymes

  • Characterizing feedback mechanisms between membrane composition and plsY function

  • Developing systems biology models that accurately predict plsY activity under different conditions

3. Host-Pathogen Interactions:
For pathogenic E. coli O8 strains, understanding how plsY contributes to host-pathogen interactions presents a significant challenge:

  • Investigating how plsY-mediated changes in membrane composition affect bacterial survival in host environments

  • Determining if plsY activity is modulated during infection processes

  • Exploring host immune recognition of bacterial membrane components synthesized through plsY activity

  • Assessing whether strain-specific plsY variants contribute to differences in pathogenicity or host range

Translational Challenges and Priorities:

1. Therapeutic Target Development:
Exploiting plsY as a potential antimicrobial target presents both opportunities and challenges:

  • Identifying selective inhibitors that target bacterial plsY without affecting mammalian lipid metabolism

  • Developing high-throughput screening assays suitable for drug discovery campaigns

  • Addressing potential resistance mechanisms that might emerge against plsY inhibitors

  • Evaluating the efficacy of targeting plsY in relevant infection models

2. Biotechnological Applications:
Harnessing engineered plsY variants for biotechnology applications faces several hurdles:

  • Creating plsY variants with novel substrate specificities through rational design and directed evolution

  • Optimizing expression systems for industrial-scale production of modified membrane lipids

  • Integrating engineered plsY into synthetic pathways for biofuel or biomaterial production

  • Addressing potential metabolic bottlenecks or toxicity issues in production strains

Emerging Research Directions:

1. Single-Cell Heterogeneity:
Understanding cell-to-cell variability in plsY expression and activity represents an emerging frontier:

  • Developing single-cell methods to measure plsY activity and membrane composition

  • Investigating how heterogeneity in plsY function contributes to population-level phenotypes

  • Characterizing stochastic aspects of plsY expression and their functional consequences

  • Exploring potential bet-hedging strategies involving differential plsY activity

2. Environmental Adaptation Mechanisms:
How plsY function adapts to changing environmental conditions requires deeper investigation:

  • Characterizing temperature-dependent changes in enzymatic properties and regulation

  • Understanding how nutrient availability affects plsY activity and substrate preference

  • Investigating adaptations to membrane stress conditions like pH fluctuations or antimicrobial compounds

  • Exploring the role of plsY in biofilm formation and maintenance

3. Synthetic Biology Frontiers:
The integration of plsY into synthetic biology applications presents exciting possibilities:

  • Developing orthogonal lipid biosynthesis pathways using engineered plsY variants

  • Creating minimal cells with designer membrane compositions through plsY engineering

  • Exploring novel phospholipid structures with industrial or pharmaceutical applications

  • Establishing biosensors based on plsY activity for environmental or diagnostic applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.