Recombinant Escherichia coli O8 Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; ECIAI1_3440; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
mscL
Target Protein Sequence
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEV LLTEIRDLLKEQNNRS
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It likely plays a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the mscL protein and what is its functional significance in E. coli?

The Large-conductance mechanosensitive channel (mscL) is a critical membrane protein in E. coli that functions as a biological pressure valve, protecting bacteria against osmotic shock. The protein forms a channel that opens in response to membrane tension, allowing the rapid efflux of cytoplasmic solutes when bacteria experience hypoosmotic stress.

MscL is encoded by the mscL gene (also known as ECIAI1_3440 in some annotation systems) and produces a 136-amino-acid protein in E. coli O8. The protein assembles into a homopentameric complex that forms a non-selective channel with one of the largest conductances known among biological channels, hence the "large-conductance" designation .

How should recombinant mscL be stored and handled in laboratory settings?

Recombinant mscL protein requires specific storage and handling conditions to maintain its structural integrity and function. Based on standard protocols:

  • Storage temperature: Store at -20°C or -80°C upon receipt.

  • Aliquoting: Divide into multiple aliquots to avoid repeated freeze-thaw cycles, which can degrade protein quality.

  • Working storage: Working aliquots may be stored at 4°C for up to one week.

  • Buffer composition: Typically maintained in Tris/PBS-based buffer with 6% Trehalose, pH 8.0.

  • Reconstitution protocol:

    • Briefly centrifuge vials before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for long-term storage

    • Standard recommendation is 50% glycerol final concentration

What expression systems are used for producing recombinant mscL?

Recombinant mscL is typically expressed in E. coli expression systems. The recommended approach involves:

  • Cloning the full-length mscL gene (encoding amino acids 1-136) into an expression vector

  • Adding an N-terminal His-tag for purification purposes

  • Transforming the construct into E. coli host cells

  • Inducing expression under controlled conditions

  • Purifying using affinity chromatography via the His-tag

  • Verifying purity (typically >90%) by SDS-PAGE analysis

How should experiments be designed to study mscL channel function?

When designing experiments to study mscL channel function, researchers should follow structured experimental design principles:

  • Clear hypothesis formulation: Establish a testable hypothesis about mscL function.

  • Variable definition:

    • Independent variables: Factors you manipulate (e.g., membrane tension, pH, ionic strength)

    • Dependent variables: Measurable outcomes (e.g., channel conductance, open probability)

    • Control variables: Factors held constant across experimental conditions

  • Control groups: Include proper controls to isolate the effects of your manipulations:

    • Negative controls (without channel activation)

    • Positive controls (known channel activators)

    • Vehicle controls (for chemical treatments)

  • Randomization: Randomly assign samples to treatment groups to minimize bias.

  • Replication: Perform sufficient biological and technical replicates to ensure statistical reliability .

The methodological rigor at this stage is crucial, as a poorly designed experiment will yield unreliable results regardless of the time and resources invested in later stages .

What approaches help resolve contradictory findings in mscL research?

Contradictory findings are common in scientific literature, including mechanosensitive channel research. To address such contradictions:

  • Evaluate sample sizes: Smaller studies are more likely to be contradicted later. Studies with larger sample sizes (e.g., n>2000) tend to be more reliable than those with smaller samples (e.g., n<600) .

  • Assess study design: Observational studies are contradicted more frequently (83% contradiction rate) than randomized controlled trials (23% contradiction rate) .

  • Consider statistical power: Underpowered studies are more prone to both false positives and false negatives.

  • Examine potential biases:

    • Financial conflicts of interest

    • Publication bias (positive results published more readily)

    • Multiple testing without appropriate corrections

  • Replicate key findings: Before building on contradictory results, attempt replication with adequate statistical power.

  • Synthesize evidence: Perform systematic reviews or meta-analyses when sufficient studies exist .

What genomic considerations are important when working with different E. coli strains expressing mscL?

E. coli has significant genomic diversity across strains that may affect mscL expression and function:

  • Strain-specific variations: E. coli strains show high rates of genetic change, with potentially different mscL variants across pathogenic and commensal strains.

  • Core vs. accessory genome: The mscL gene belongs to the approximately 2,000 genes common to all E. coli strains (out of ~18,000 orthologous gene families) .

  • Annotation considerations: Many E. coli genes are incompletely or inconsistently annotated across strains. Expert re-annotation has revealed that some strains have twice as many newly predicted genes as others, indicating that reference genomes may miss important variations .

  • Evolutionary pressure: Different functional gene classes experience opposite selection pressures across E. coli phylogenetic groups, potentially affecting membrane proteins like mscL .

  • Chromosome position effects: Genes at certain chromosomal positions show different recombination rates, which may influence expression. Positions near the terminus of replication typically show lower recombination rates .

How can researchers evaluate the quality of experimental data regarding mscL function?

Evaluating experimental data quality requires systematic assessment of multiple factors:

  • Statistical validity analysis:

    • Proper application of statistical tests appropriate to the data distribution

    • Adequate statistical power (sample size calculation)

    • Appropriate handling of multiple comparisons

    • Assessment of effect sizes rather than just p-values

  • Data robustness checklist:

    ParameterHigh QualityPotential Issue
    Sample sizeAdequately poweredUnderpowered
    ControlsComplete setMissing key controls
    ReplicationMultiple independent replicationsSingle experiment
    BlindingResearchers blinded to conditionsUnblinded assessment
    Method validationMethods validatedMethods unverified
    Data availabilityRaw data accessibleOnly processed data reported
  • Reproducibility assessment: Can the findings be reproduced by:

    • The same lab with different samples

    • Different labs with similar protocols

    • Different methods addressing the same question

What are the key methodological considerations for functional reconstitution of mscL in membrane systems?

Functional reconstitution of mscL requires specialized approaches to maintain native-like membrane environments:

  • Lipid composition optimization:

    • Match lipid composition to bacterial membrane when possible

    • Systematically test effects of lipid headgroups, acyl chain length, and saturation

    • Control membrane thickness, which affects mscL gating threshold

  • Reconstitution methods comparison:

    MethodAdvantagesLimitations
    LiposomesNative-like bilayer, versatileVariable size, difficult to control orientation
    Planar lipid bilayersElectrical access to both sidesTechnical difficulty, short stability
    NanodiscsDefined size, stableLimited area, edge effects
    Giant unilamellar vesiclesLarge size for microscopyChallenging preparation, fragility
  • Protein-to-lipid ratio optimization: Titrate to achieve functional channels while avoiding protein aggregation. Typical starting ratios range from 1:100 to 1:10000 (w/w).

  • Tension application methods:

    • Osmotic gradients

    • Micropipette aspiration

    • Controlled pressure systems

    • Amphipathic compounds

    • Membrane stretching devices

  • Functional verification approaches:

    • Patch-clamp electrophysiology

    • Fluorescence-based flux assays

    • EPR spectroscopy

    • Single-molecule FRET

How should researchers address potential experimental artifacts in mscL structural studies?

Mechanosensitive channels are particularly prone to experimental artifacts due to their sensitivity to membrane environment and mechanical forces:

  • Expression system artifacts:

    • Overexpression can lead to misfolding or aggregation

    • Expression host membrane composition differs from native environment

    • Solution: Use controlled expression levels and consider native membrane mimetics

  • Purification-related structural changes:

    • Detergent effects on protein structure

    • Removal from native lipid environment

    • Potential loss of interacting proteins

    • Solution: Screen multiple detergents, consider lipid-detergent mixtures

  • Reconstitution artifacts:

    • Incorrect orientation in membrane

    • Non-physiological lipid composition

    • Mechanical stress during reconstitution

    • Solution: Verify orientation, systematically test lipid compositions

  • Structure determination method-specific artifacts:

    MethodPotential ArtifactsVerification Approaches
    X-ray crystallographyCrystal packing forces, detergent effectsMultiple crystal forms, functional validation
    Cryo-EMPreferred orientations, deformation during freezingMultiple sample preparations, tilted data collection
    NMRDetergent/solvent effects, averaging of dynamic statesMultiple solution conditions, cross-validation
    MD simulationsForce field limitations, simulation timescaleMultiple force fields, experimental validation
  • Cross-validation strategy: Combine multiple structural methods (X-ray, Cryo-EM, FRET, EPR) to verify consistent structural features.

What strategies help distinguish genuine mechanosensitivity from experimental artifacts in electrophysiological recordings?

Electrophysiological studies of mechanosensitive channels face unique challenges in differentiating true mechanosensitivity from artifacts:

  • Control experiments critical checklist:

    • Patch stability controls without applied tension

    • Empty liposome/bilayer controls

    • Inactive mutant controls

    • Alternative tension application methods to cross-validate

  • Tension quantification approaches:

    MethodAdvantagesLimitations
    Membrane curvature measurementDirect measurementTechnically challenging
    Pressure calibrationStraightforward applicationIndirect measurement of tension
    Micropipette aspirationWell-establishedLimited to certain preparations
    Fluorescent tension reportersCan map spatial tensionRequires specialized probes
  • Verification of channel identity:

    • Characteristic conductance and subconductance states

    • Specific pharmacological modulators when available

    • Known mutational effects on gating parameters

    • Comparison with published data for the same channel

  • Addressing common artifacts:

    • Membrane rupture events versus channel openings

    • Mechanical disruption of seal versus channel activity

    • Background channel activity versus mscL

    • Reconstitution-induced changes in gating properties

  • Statistical rigor requirements:

    • Large number of independent recordings

    • Multiple protein preparations

    • Various expression systems or reconstitution methods

    • Quantitative analysis of channel properties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.