Recombinant Escherichia coli O8 Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; ECIAI1_3885; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-548
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
yidC
Target Protein Sequence
MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKL ISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGP DNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNV QNAGEKPLEISTFGQLKQSITLPPHLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD NENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQT GAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVNPL GGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQK MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL HSREKKKS
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and/or complex formation of integral membrane proteins into the membrane. Plays a role in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Contributes to the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its primary function in E. coli?

YidC is a 61 kDa membrane protein in Escherichia coli that functions as a membrane insertase, playing a crucial role in the insertion of newly synthesized membrane proteins into the lipid bilayer. YidC is specifically used for the insertion of membrane proteins and not for the translocation of exported proteins . It recognizes hydrophobic regions of membrane proteins and catalyzes their integration into a transmembrane orientation within the membrane bilayer . YidC belongs to the evolutionarily conserved YidC/Oxa1/Alb3 family of membrane protein insertases found across bacteria, archaea, and eukaryotic organelles .

What is the structural organization of YidC?

YidC consists of:

  • Five conserved transmembrane helices (TM2-TM6), excluding the non-conserved first transmembrane helix (TM1)

  • A large periplasmic domain (P1) between the first two conserved transmembrane regions

  • A hydrophilic groove that serves as the substrate insertion site

  • A cytoplasmic hydrophilic peptide domain (HPD) that is not essential for function in E. coli

How do interactions between YidC's transmembrane helices contribute to protein stability and function?

The stability of YidC is maintained through a complex network of interactions within its transmembrane region. Molecular dynamics simulations revealed that:

  • The exterior of the transmembrane bundle contains hydrophobic residues that stabilize interactions with apolar lipid tails .

  • The YidC core is stabilized through both short and long-range interactions between its five helices .

  • Residues toward the cytoplasmic side of the core are primarily polar or charged and engage in strong electrostatic or charge-dipole interactions .

  • Residues on the periplasmic side are primarily aromatic and involved in stacking and other nonpolar dispersion interactions .

Functional studies identified critical residues for YidC activity. Alanine mutations of key stabilizing residues T362 in TM2 and Y517 in TM6 completely inactivated YidC despite the protein being stably expressed . This indicates these residues are crucial for function rather than merely structural stability. Several residues close to this pair (F433, M471, and F505) showed intermediate activity levels when mutated, while mutations of residues further away had no effect .

What is the catalytic mechanism of YidC-mediated membrane insertion?

YidC functions catalytically in membrane insertion. Reconstitution studies demonstrated that when more than five molecules of YidC were present in each liposome, efficient membrane insertion occurred, with approximately 150 Pf3 coat protein molecules inserted per YidC molecule . This suggests YidC acts as a true catalyst rather than forming a static channel.

The most efficient insertion occurred at a density of about 25 YidC molecules per liposome, corresponding to a protein:lipid ratio of 1:25,000 . The catalytic mechanism likely involves:

  • Recognition of hydrophobic regions in substrate proteins

  • Creation of a protected hydrophilic environment

  • Facilitation of transmembrane orientation

  • Release of the inserted protein into the lipid bilayer

Cross-linking studies with single cysteine mutants have shown that the transmembrane domain of the nascent chain directly interacts with TM3 of YidC during insertion, providing insights into the precise contact points during the insertion process .

How does YidC interact with ribosomes during co-translational membrane protein insertion?

YidC interacts directly with the ribosome during co-translational membrane protein insertion. Cryo-electron microscopy and molecular modeling have identified specific residues in YidC that contact the ribosome:

  • Residues Y370 and Y377 contact ribosomal RNA helix 59

  • Residue D488 contacts ribosomal protein uL23

Mutation of these residues (Y370A, Y377A, and D488K) severely impaired YidC activity in vivo, emphasizing their functional significance in ribosome interaction . These contact points are positioned where the newly formed protein chain exits the ribosome, creating an optimized path for membrane insertion .

The interaction positions YidC to receive nascent membrane proteins directly from the ribosome exit tunnel, facilitating their immediate insertion into the membrane and preventing exposure to the cytoplasmic environment where aggregation might occur.

What are the best approaches for reconstituting YidC for functional studies?

For functional reconstitution of YidC, researchers should consider:

Protocol for YidC Reconstitution into Liposomes:

  • Purify YidC with a histidine tag for affinity purification

  • Prepare liposomes with a defined lipid composition (e.g., 3:1 POPE:POPG mixture has been successfully used for modeling bacterial membranes)

  • Add purified YidC to preformed liposomes

  • Subject to freeze-thaw cycles to ensure incorporation

  • Verify successful reconstitution through protease protection assays

For optimal function, maintain a protein:lipid ratio of approximately 1:25,000, with about 25 YidC molecules per liposome . This density has been shown to support the most efficient insertion activity.

To assess the orientation of reconstituted YidC, perform protease protection assays. A properly oriented YidC will yield a trypsin-resistant fragment of 42 kDa, which includes the large periplasmic domain between the first two transmembrane regions .

How can researchers effectively analyze YidC-substrate interactions during membrane insertion?

Several complementary approaches provide insights into YidC-substrate interactions:

  • Disulfide Crosslinking:

    • Generate single cysteine mutants in both YidC (e.g., M430C and P431C in TM3 or V500C and T503C in TM5) and the substrate protein

    • Reconstitute with ribosome-nascent chain complexes (RNCs)

    • Induce disulfide formation with oxidizing agents like 5,5'-dithiobis-(2-nitrobenzoicacid) (DTNB)

    • Analyze crosslinked products by SDS-PAGE and immunoblotting with antibodies against both YidC and the nascent chain

  • Molecular Dynamics Simulations:

    • Embed YidC model in a membrane with appropriate lipid composition (3:1 POPE:POPG)

    • Solvate with water layers and neutralize with ions

    • Use force fields like CHARMM36 for proteins and lipids, and TIP3P for water

    • Analyze interaction energies, hydrogen bonds, and membrane thinning effects

  • In Vivo Complementation Assays:

    • Generate alanine mutants of potential interaction residues

    • Test their ability to complement YidC depletion in conditional lethal strains

    • Analyze protein expression levels to ensure that loss of function is not due to instability

What methods are most effective for studying the YidC-SecYEG interaction?

The interaction between YidC and the SecYEG translocon can be effectively studied through:

  • Co-purification Approaches:

    • Express both YidC (with a His-tag) and SecYEG components

    • Purify via affinity chromatography targeting YidC

    • Analyze co-purified components by immunoblotting with antibodies against SecY

  • In Vivo Crosslinking:

    • Treat cells expressing YidC or co-expressing SecYEG-YidC with paraformaldehyde (PFA)

    • Purify YidC via its His-tag

    • Analyze crosslinked products using antibodies against SecY

    • A characteristic 95 kDa crosslink product will be detected by α-SecY antibodies in the co-expression system, but not when only YidC is expressed

  • Co-expression Systems:

    • Design systems with stoichiometric amounts of YidC and SecYEG to enable efficient crosslinking

    • Approximately equimolar amounts are required for optimal detection of interactions

How should researchers evaluate evolutionary conservation data for YidC structural modeling?

When analyzing evolutionary conservation for YidC structural modeling:

  • Multiple Sequence Alignment Preparation:

    • Start with a curated seed alignment (e.g., PFAM seed alignment of family PF02096)

    • Use sensitive homology detection software like HHblits for sequence searches

    • Run multiple iterations against clustered databases without filtering to maximize homology detection

    • Post-process the alignment to generate a non-redundant set (e.g., at 90% sequence identity)

    • Focus on the conserved regions (TM2-TM6), excluding variable domains like TM1 and P1

  • Covariation Analysis:

    • Compute direct evolutionary couplings between pairs of YidC residues

    • Look for diagonal and anti-diagonal patterns of stronger coupling coefficients, which indicate parallel or anti-parallel helix-helix pairs

    • Calculate probabilities for each possible helix-helix contact by aggregating evidence of stronger coupling coefficients

    • Calibrate raw scores on independent datasets of known helix-helix interactions

    • Consider contacts with probabilities above ~57% as significant, while those below ~15% can be considered non-specific

  • Model Validation:

    • Compare predicted contacts with experimental structures when available

    • Assess model stability through molecular dynamics simulations

    • Verify functional relevance of key residues through mutagenesis and in vivo complementation assays

    • Calculate RMSD between model and experimental structures (values of 7.3-7.5Å are within resolution limits of covariation methods)

What criteria should be used to evaluate YidC reconstitution efficiency in proteoliposomes?

To properly evaluate YidC reconstitution efficiency, researchers should consider:

ParameterOptimal ValueAssessment MethodNotes
Protein:Lipid Ratio1:25,000Protein and lipid quantificationCorresponds to ~25 YidC molecules per liposome
OrientationPeriplasmic region insideProtease protection assayShould yield a 42 kDa trypsin-resistant fragment
Insertion Activity~150 substrate molecules per YidCQuantitative insertion assayIndicates catalytic activity rather than stoichiometric action
Minimal Functional Density>5 YidC molecules per liposomeTitration experimentsThreshold for efficient insertion
Membrane IntegrityNo leakageFluorescent dye encapsulationEnsures insertion rather than translocation

For quantitative insertion assays, researchers should:

  • Use purified substrate proteins (e.g., Pf3 coat protein)

  • Measure insertion kinetics (typically occurring within minutes)

  • Determine insertion efficiency at various YidC concentrations

  • Calculate the number of substrate molecules inserted per YidC molecule

How can contradictory findings about YidC function be reconciled in research literature?

When facing contradictory findings about YidC function, consider:

  • Substrate-specific effects:

    • YidC may interact differently with Sec-dependent versus Sec-independent substrates

    • Different substrates may require different regions or residues of YidC

    • Create a classification system based on substrate dependence on YidC features

  • Experimental conditions:

    • In vitro versus in vivo studies may yield different results

    • Lipid composition significantly affects membrane protein insertion

    • Temperature, pH, and ionic conditions influence membrane protein folding and insertion

  • Species-specific differences:

    • Compare data from E. coli YidC (61 kDa) with homologs from other organisms

    • Consider that while the YidC/Oxa1/Alb3 family is conserved, specific functions may differ

    • Note structural differences, such as between E. coli YidC and B. halodurans YidC2 (34% sequence identity)

  • Domain contributions:

    • The hydrophilic peptide domain (HPD) is not essential for YidC function in E. coli

    • The P1 domain shows significant flexibility, which may account for functional variability

    • TM1 is not conserved and may have species-specific functions

What are the implications of the evolutionary relationship between SecY and YidC?

Recent research suggests a unified evolutionary origin for SecY and YidC , which has significant implications:

  • The evolutionary connection between these two critical membrane protein insertion systems suggests they may share fundamental mechanistic principles.

  • This relationship could explain their functional cooperation in membrane protein biogenesis, with YidC working both independently and with SecYEG.

  • Future research directions should explore:

    • The evolutionary transition from a common ancestor to specialized insertion machines

    • Conserved mechanistic features between the two systems

    • Potential for hybrid systems with combined features in synthetic biology applications

What are promising approaches for manipulating YidC to enhance recombinant membrane protein production?

Based on current understanding of YidC function, several approaches could enhance recombinant membrane protein production:

  • Co-expression strategies:

    • Coordinate expression of YidC with target membrane proteins

    • Balance YidC:SecYEG ratios for optimal insertion of different substrate classes

    • Consider co-expression of chaperones to prevent aggregation of membrane protein intermediates

  • Engineered YidC variants:

    • Design YidC mutants with enhanced substrate recognition based on structure-function studies

    • Create chimeric proteins combining features of YidC homologs from different species

    • Engineer variants with modified ribosome binding sites to enhance co-translational insertion

  • Optimized reconstitution systems:

    • Develop defined proteoliposome systems with controllable lipid composition

    • Create artificial membrane systems that mimic the native environment for YidC function

    • Design coupled transcription-translation-insertion systems for one-pot membrane protein production

  • Application-specific considerations:

    • For structural studies, focus on stabilizing interaction networks within target membrane proteins

    • For functional studies, ensure proper orientation and folding by monitoring activity assays

    • For biotechnological applications, maximize insertion efficiency through optimization of YidC concentration and membrane properties

What technological advances are needed to further elucidate YidC mechanism at the molecular level?

Several technological advances would significantly enhance our understanding of YidC:

  • Time-resolved structural studies:

    • Development of methods to capture intermediate states during insertion

    • Time-resolved cryo-EM to visualize conformational changes during the insertion process

    • Single-molecule FRET to monitor dynamic interactions between YidC and substrates

  • Advanced computational approaches:

    • Enhanced molecular dynamics simulations incorporating larger systems and longer timescales

    • Machine learning approaches to predict substrate recognition and insertion efficiency

    • Quantum mechanical calculations of critical interaction energies during insertion

  • In situ studies:

    • Development of methods to study insertion in intact cells

    • Super-resolution microscopy to visualize YidC localization and dynamics

    • Technologies to manipulate and monitor individual insertion events in living cells

  • Novel biochemical tools:

    • Development of substrates with built-in reporters of insertion state

    • Creation of YidC variants with environmentally sensitive probes

    • Design of artificial substrates to test specific aspects of the insertion mechanism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.