Recombinant Escherichia coli O8 NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Escherichia coli O8 NADH-quinone oxidoreductase subunit K (NuoK) is a genetically engineered protein component of respiratory complex I (NADH:ubiquinone oxidoreductase). This enzyme catalyzes electron transfer from NADH to ubiquinone in the bacterial respiratory chain, coupled with proton translocation across the cytoplasmic membrane . The recombinant NuoK protein is expressed in E. coli with an N-terminal His tag for purification and structural studies .

Functional Role in Complex I

  • Assembly: Disruption of nuoK prevents the formation of a fully functional complex I, leading to loss of enzymatic activity and structural instability .

  • Electron Transfer: NuoK contributes to the stability of iron-sulfur clusters (e.g., N2) essential for electron transport .

  • Proton Translocation: While not directly involved in redox reactions, NuoK supports the membrane domain’s proton-pumping machinery .

Mutational Studies

  • Disruption Effects: nuoK deletion in E. coli results in partially assembled complexes lacking cluster N2, rendering them enzymatically inactive .

  • Activity Loss: Mutants show no NADH:ubiquinone oxidoreductase activity, confirming NuoK’s role in complex I assembly .

Applications in Research

  • Enzyme Reconstitution: Used to study complex I assembly and dysfunction linked to mitochondrial diseases .

  • Biochemical Assays: Purified NuoK aids in probing proton translocation mechanisms and inhibitor screening .

  • Comparative Studies: Facilitates comparisons with homologous subunits in pathogenic bacteria (e.g., Vibrio cholerae Na+-NQR) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery details, please consult your local distributor.
Note: All protein shipments are standardly sent with blue ice packs. If you require dry ice shipping, please contact us beforehand, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein with deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. To enhance long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life extends to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preference for a particular tag, please inform us, and we will prioritize developing it accordingly.
Synonyms
nuoK; ECIAI1_2353; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, employing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, the enzyme's immediate electron acceptor is believed to be ubiquinone. The redox reaction is coupled to proton translocation, where for every two electrons transferred, four hydrogen ions are moved across the cytoplasmic membrane. This process conserves redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the NuoK subunit and what is its significance in bacterial NDH-1?

NuoK is one of the seven hydrophobic subunits in the membrane domain of bacterial NADH:quinone oxidoreductase (NDH-1). It is the Escherichia coli homologue of the mitochondrial ND4L subunit, which is the smallest mitochondrial DNA-encoded subunit of proton-translocating NADH-quinone oxidoreductase (complex I). NuoK bears three transmembrane segments (TM1-3) and plays a critical role in the energy transduction mechanism of NDH-1. The membrane domain of NDH-1, which includes NuoK, is embedded in the cytoplasmic membrane and is believed to participate in proton translocation, as well as in the binding of quinone and inhibitors .

The significance of NuoK becomes evident from mutation studies where alterations to conserved residues within this subunit dramatically affect the coupled electron transfer activities of NDH-1. This suggests that despite its small size, NuoK is essential for the proper functioning of the entire NDH-1 complex, particularly in coupling electron transfer with proton translocation .

How does the structure of NuoK relate to its function in energy transduction?

NuoK contains three transmembrane segments (TM1-3) with two critically important glutamic acid residues (Glu-36 in TM2 and Glu-72 in TM3) located in adjacent transmembrane helices. These conserved carboxyl residues are positioned within the membrane domain and play crucial roles in the energy coupling mechanism. The structural arrangement of these acidic residues allows them to potentially participate in proton translocation across the membrane .

Additionally, NuoK contains a significant cytosolic loop between TM1 and TM2 (loop-1) with conserved arginine residues (Arg-25 and Arg-26) that have been shown to be important for energy transduction. The proximity of these positively charged residues to the membrane interface likely facilitates interactions necessary for conformational changes during the catalytic cycle of NDH-1 .

NuoK Structural ElementLocationFunctional Significance
Glu-36Transmembrane segment 2 (TM2)Critical for coupled activities; mutation leads to almost complete loss of activity
Glu-72Transmembrane segment 3 (TM3)Important for coupled activities; mutation causes moderate reduction
Arg-25, Arg-26Cytosolic loop between TM1 and TM2Double mutation severely impairs energy transduction
Asn-27Cytosolic loop between TM1 and TM2Part of the functionally important loop-1 region

What are the conserved residues in NuoK and why are they important?

Several highly conserved residues in NuoK have been identified as critical for NDH-1 function. The most significant are:

  • Glu-36: This nearly perfectly conserved glutamic acid residue is located in TM2. Mutations of this residue to alanine lead to almost null activities of coupled electron transfer with a concomitant loss of electrochemical gradient generation. This suggests that Glu-36 is absolutely essential for the coupling mechanism of NDH-1 .

  • Glu-72: Another highly conserved glutamic acid residue located in TM3. Mutations of this residue cause a significant reduction in coupled activities, though less severe than Glu-36 mutations. This indicates that Glu-72 also plays an important, though perhaps secondary, role in the coupling mechanism .

  • Arg-25 and Arg-26: These vicinal arginine residues are located on a cytosolic loop (loop-1) between TM1 and TM2. Simultaneous mutation of these residues results in severe impairment of coupled activities, suggesting they play a critical role in energy transduction, possibly by facilitating conformational changes or interacting with other subunits .

These conserved residues are important because they appear to form essential components of the proton translocation machinery, either by directly participating in proton transfer or by enabling conformational changes necessary for coupling electron transfer to proton pumping .

What are the most effective methods for site-directed mutagenesis studies of NuoK?

For studying the functional and structural roles of NuoK, homologous recombination techniques have proven highly effective for performing site-specific mutations on the nuoK gene within the NDH-1 operon. This approach allows researchers to create precise alterations to targeted amino acid residues while maintaining the natural genetic context of the gene .

When designing mutation studies for NuoK, researchers should consider:

  • Target Selection: Focus on highly conserved residues identified through sequence alignment across species. Particularly valuable targets include membrane-embedded acidic residues (like Glu-36 and Glu-72) and charged residues at membrane interfaces (like Arg-25 and Arg-26) .

  • Mutation Strategy: Consider both conservative and non-conservative substitutions. For example, replacing glutamic acid with aspartic acid (conservative) versus alanine (non-conservative) can provide different insights into the role of charge versus size of the residue .

  • Relocation Studies: Beyond simple substitutions, relocating conserved residues along the same transmembrane helix can provide valuable information about the importance of specific positioning. For instance, shifting Glu-36 along TM2 to positions 32, 38, 39, and 40 revealed that these locations, which fall in the same helix phase and are within one helix turn, can still support energy transducing activities .

How can researchers effectively assess the impact of NuoK mutations on NDH-1 assembly and function?

To comprehensively evaluate the effects of NuoK mutations, several complementary techniques should be employed:

  • Assembly Verification: Blue-native gel electrophoresis combined with immunostaining is an effective method to determine whether mutant NuoK subunits still allow for complete assembly of the NDH-1 complex. This is a crucial first step to distinguish between assembly defects and functional defects .

  • Electron Transfer Activity: Measuring NADH oxidation rates using artificial electron acceptors can assess the basic electron transfer function of NDH-1 with mutated NuoK. This provides information about whether the core catalytic activity remains intact .

  • Proton Pumping Measurement: Techniques to measure the generation of electrochemical gradients are essential to evaluate the coupling efficiency between electron transfer and proton translocation. Reduced or absent gradient formation despite normal electron transfer indicates a specific defect in the coupling mechanism .

  • Combined Approach: A comprehensive assessment should include both measurement of coupled electron transfer activities and evaluation of electrochemical gradient generation to fully characterize the functional impact of mutations .

Analytical MethodPurposeWhat It Reveals
Blue-native gel electrophoresis with immunostainingVerify complex assemblyWhether NuoK mutation affects structural integrity of NDH-1
NADH oxidation assayMeasure electron transferBasic catalytic function independent of proton pumping
Membrane potential measurementsAssess proton translocationCoupling efficiency between electron transfer and proton pumping
Sequence conservation analysisGuide mutation target selectionEvolutionary importance of specific residues

What controls should be included when studying recombinant NuoK in E. coli?

When designing experiments to study recombinant NuoK in E. coli, several critical controls should be included:

  • Wild-type Controls: Always include the wild-type NuoK for direct comparison with mutants to establish baseline activity levels and assembly patterns .

  • Negative Controls: Include known non-functional mutants (like Glu-36 to Ala) that completely abolish activity as reference points for the severity of functional defects .

  • Conservative Mutation Controls: Include mutations that preserve the chemical properties of key residues (e.g., Glu to Asp) to distinguish between the importance of the specific residue versus its general chemical property .

  • Assembly Verification: For each mutant, verify proper assembly of the complete NDH-1 complex to ensure that any observed functional defects are not simply due to assembly failure .

  • Strain Background Controls: When using different E. coli strains, account for potential strain-specific effects on expression, assembly, or activity of the NDH-1 complex .

  • Expression Level Controls: Monitor expression levels of recombinant NuoK to ensure that functional differences are not simply due to variable expression .

How do the conserved glutamic acid residues in NuoK contribute to the proton translocation mechanism?

The two conserved glutamic acid residues in NuoK (Glu-36 in TM2 and Glu-72 in TM3) play critical but potentially different roles in the proton translocation mechanism of NDH-1:

  • Glu-36 (TM2): This nearly perfectly conserved residue appears to be absolutely essential for the coupling mechanism. Mutation to alanine results in almost complete loss of coupled activities while basic electron transfer remains intact. This suggests that Glu-36 is directly involved in proton translocation, potentially serving as a proton donor/acceptor within the membrane domain. Its location in the middle of TM2 positions it optimally to participate in a proton transfer pathway across the membrane .

  • Glu-72 (TM3): While also highly conserved, mutations of this residue cause a significant but less severe reduction in coupled activities compared to Glu-36 mutations. This suggests Glu-72 plays an important supporting role in the coupling mechanism, possibly as a secondary proton transfer site or by facilitating conformational changes necessary for efficient proton translocation .

The proximity of these two residues in adjacent transmembrane helices suggests they may work cooperatively in the proton translocation pathway. Their membrane-embedded location is consistent with the requirement for charged residues capable of accepting and donating protons within the hydrophobic environment of the membrane .

Interestingly, relocation studies of Glu-36 demonstrated that shifting this residue along TM2 to positions that maintain the same helical phase (positions 32, 38, 39, and 40) still allows for substantial retention of energy transducing activities. This indicates some flexibility in the precise positioning of this critical residue, as long as it remains within the same face of the helix and within one helical turn of its native position .

What is the significance of the cytosolic loop between TM1 and TM2 in NuoK function?

The cytosolic loop between transmembrane segments 1 and 2 (loop-1) in NuoK contains several conserved residues that are crucial for NDH-1 function, particularly the adjacent arginine residues (Arg-25 and Arg-26) and Asn-27:

  • Arg-25 and Arg-26: Double mutation of these positively charged residues has a dramatic effect on energy transducing activities, suggesting they play a vital role in the coupling mechanism. Their location in a cytosolic loop positions them at the membrane interface, where they could potentially:

    • Interact with other subunits of the NDH-1 complex

    • Facilitate conformational changes during the catalytic cycle

    • Contribute to the formation of a proton uptake pathway

    • Stabilize the membrane domain structure through electrostatic interactions

  • Asn-27: This residue, adjacent to the arginine pair, is also part of the functionally important loop-1 region. Together with Arg-25 and Arg-26, it likely contributes to the specific structural arrangement necessary for proper function of NuoK within the NDH-1 complex .

The importance of this cytosolic loop has been extensively studied, with results confirming its critical role in energy transduction. The positioning of these charged residues at the cytoplasmic membrane interface is strategic, potentially allowing them to serve as connection points between the membrane domain and the peripheral arm of NDH-1, facilitating communication between these domains during the coupling of electron transfer to proton translocation .

How does the bacterial NuoK compare to its mitochondrial counterpart ND4L in structure and function?

NuoK in bacteria and ND4L in mitochondria are homologous subunits with several important similarities and differences:

Similarities:

  • Both are small, hydrophobic membrane subunits with multiple transmembrane segments within their respective complex I/NDH-1 enzymes .

  • Both participate in the coupling mechanism that connects electron transfer to proton translocation .

  • Key functional residues, particularly the conserved glutamic acids in transmembrane helices, are preserved between bacterial NuoK and mitochondrial ND4L, indicating their fundamental importance to the coupling mechanism .

  • Both subunits are positioned within the membrane domain of their respective complexes .

Differences:

  • ND4L is encoded by mitochondrial DNA, while NuoK is encoded in the bacterial chromosome as part of the NDH-1 operon .

  • The bacterial NDH-1 complex (containing NuoK) is simpler than the mitochondrial complex I (containing ND4L), consisting of only 13-14 subunits compared to approximately 45 in the mitochondrial enzyme .

  • Specific interactions with other subunits may differ between the bacterial and mitochondrial systems due to the additional subunits present in the mitochondrial complex .

Despite these differences, the bacterial NDH-1 system serves as an excellent model for studying the core functions of complex I, as all bacterial subunits have homologs in the central core of the mitochondrial enzyme. This makes insights gained from NuoK studies highly relevant to understanding the function of mitochondrial ND4L and the coupling mechanism of complex I in general .

How should researchers approach contradictory data in NuoK functional studies?

When facing contradictory data in NuoK functional studies, researchers should follow a systematic approach:

Approach to Contradictory DataApplication to NuoK Research
Data ExaminationCompare activity measurements across different mutation types
Methodology AssessmentEvaluate differences in expression systems or assay conditions
Sample Preparation ReviewExamine membrane preparation and protein extraction protocols
Alternative Hypothesis DevelopmentConsider indirect effects on complex assembly or stability
Complementary Technique ValidationCombine activity assays with structural and assembly analysis

What experimental design considerations help minimize data conflicts in NuoK mutation studies?

To minimize contradictory data in NuoK mutation studies, researchers should implement robust experimental design strategies:

How can researchers distinguish between direct and indirect effects of NuoK mutations?

Distinguishing between direct and indirect effects of NuoK mutations is crucial for accurate interpretation of functional studies:

What are the major challenges in expressing and studying recombinant NuoK?

Researchers face several significant challenges when expressing and studying recombinant NuoK:

  • Membrane Protein Expression: As a hydrophobic membrane protein with multiple transmembrane segments, NuoK can be difficult to express at high levels in recombinant systems. Expression may lead to toxicity, aggregation, or inclusion body formation .

  • Complex Assembly: NuoK functions as part of the multi-subunit NDH-1 complex, making it challenging to study in isolation. Researchers must ensure proper assembly of the entire complex to evaluate NuoK function accurately .

  • Activity Measurement: Distinguishing between electron transfer and proton pumping activities requires specialized techniques. Measuring the coupling efficiency accurately is particularly challenging and requires careful experimental design .

  • Stability Issues: The hydrophobic nature of NuoK makes it potentially unstable when removed from its native membrane environment, complicating purification and in vitro studies .

  • Genetic Manipulation: Introducing mutations to the chromosomal nuoK gene while maintaining the integrity of the NDH-1 operon requires sophisticated genetic techniques like homologous recombination .

What strategies help overcome difficulties in measuring NuoK-associated activities?

To overcome challenges in measuring NuoK-associated activities in NDH-1, researchers can employ several effective strategies:

  • Complementary Activity Assays: Combine multiple assay types to get a complete picture of NDH-1 function:

    • NADH oxidation assays for basic electron transfer

    • Proton pumping measurements for coupling efficiency

    • Membrane potential monitoring for electrochemical gradient formation

  • Reconstitution Systems: Reconstitute purified NDH-1 complexes containing wild-type or mutant NuoK into liposomes to create a controlled environment for functional studies. This allows for precise measurement of proton pumping activities separate from cellular background .

  • In situ Analysis: Develop techniques to measure NDH-1 activities in intact membrane vesicles or cells, maintaining the native environment of the complex and avoiding potential artifacts from purification or reconstitution .

  • Spectroscopic Approaches: Utilize advanced spectroscopic methods to monitor electron transfer within the complex, providing insights into how NuoK mutations affect electron flow through the peripheral arm to the membrane domain .

  • Comparative Analysis: Always run wild-type and known mutant controls in parallel with new mutants to establish a clear baseline for activity comparisons and account for day-to-day variations in experimental conditions .

How can researchers effectively interpret the evolutionary significance of conserved residues in NuoK?

To interpret the evolutionary significance of conserved residues in NuoK, researchers should implement the following approaches:

  • Comprehensive Sequence Alignment: Perform extensive alignments of NuoK/ND4L sequences across diverse species, from bacteria to mammals, to identify truly conserved residues that have withstood evolutionary pressure. The most critical functional residues typically show the highest conservation .

  • Conservation Pattern Analysis: Look beyond simple conservation to analyze patterns:

    • Absolute conservation (identical residues) versus similar character conservation

    • Co-evolution of multiple residues that may function together

    • Conservation within specific phylogenetic lineages

  • Structural Context Evaluation: Map conserved residues onto structural models of NuoK to understand their spatial relationships. Clusters of conserved residues often indicate functional sites for proton channels, conformational changes, or subunit interactions .

  • Functional Correlation: Correlate the degree of conservation with the severity of functional defects when these residues are mutated. The most severe functional impacts typically align with the most highly conserved residues, as seen with Glu-36 in NuoK .

  • Comparative Biochemistry: Compare the biochemical properties of NuoK across species with different energy metabolism requirements. Species-specific adaptations in otherwise conserved regions may reveal insights into the flexibility of the coupling mechanism under different evolutionary pressures .

  • Pathogenic Variant Analysis: Examine known pathogenic mutations in human ND4L (the mitochondrial homolog of NuoK) associated with mitochondrial diseases. These natural "experiments" can provide valuable insights into the functional importance of specific residues .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.