Recombinant Escherichia coli O8 p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeA; ECIAI1_3383; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
aaeA
Target Protein Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHDNQLVKKGQILFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DDKGMATIDSNLEWVRLAQRVPVRICLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR KMAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the AaeA efflux pump subunit and what is its function in Escherichia coli?

AaeA (formerly known as YhcQ) is a membrane fusion protein that functions as a critical component of the AaeAB efflux pump system in Escherichia coli. This system specifically exports aromatic carboxylic acids, including p-hydroxybenzoic acid (pHBA) and related compounds, from the bacterial cell . The AaeA subunit works in conjunction with AaeB (formerly YhcP), which is the transporter protein component of the system. Together, they form a functional efflux pump that spans the cell envelope, allowing for the efficient export of potentially toxic metabolites . The physiological role of this system appears to be as a "metabolic relief valve" that helps alleviate the toxic effects of imbalanced metabolism, particularly when aromatic carboxylic acids accumulate to harmful levels .

The expression of the aaeA gene is tightly regulated and specifically induced by the presence of aromatic carboxylic acids in the cellular environment. This regulation is primarily controlled by the LysR-family transcriptional regulator AaeR (formerly YhcS), which responds to the presence of substrate molecules and activates transcription of the aaeAB operon . This highly selective regulation pattern underscores the specialized nature of this efflux system and its importance in bacterial metabolic homeostasis.

How is the aaeA gene organized within the aae gene cluster and how is its expression regulated?

  • aaeR (yhcS) - Encodes a LysR-family transcriptional regulator

  • aaeX (yhcR) - Encodes a small protein without a clearly defined function

  • aaeA (yhcQ) - Encodes the membrane fusion protein component

  • aaeB (yhcP) - Encodes the transporter protein component

The expression of the aaeXAB operon is primarily controlled by the AaeR regulator, which binds to the promoter region in response to aromatic carboxylic acids that serve as inducers . Experimental evidence has shown that treatment of E. coli with p-hydroxybenzoic acid (pHBA) results in significant upregulation of these genes, demonstrating their inducible nature . The tight regulation of this system suggests that its expression is carefully controlled to respond specifically to metabolic imbalances or environmental stressors that result in the accumulation of aromatic carboxylic acids.

Mutational studies have further confirmed the regulatory relationship, as yhcS (aaeR) mutant strains show hypersensitivity to pHBA, similar to yhcP (aaeB) mutants . This hypersensitivity can be suppressed by expression of yhcQ (aaeA) and yhcP (aaeB), confirming the functional relationship between these genes and their products .

What experimental approaches are used to study AaeA expression in laboratory settings?

Researchers employ several methodologies to study AaeA expression in laboratory settings:

  • Gene Expression Analysis: Real-time quantitative PCR (RT-qPCR) and microarray analysis are commonly used to measure aaeA transcript levels under various conditions, particularly following exposure to aromatic carboxylic acids such as p-hydroxybenzoic acid .

  • Reporter Gene Assays: Transcriptional fusions of the aaeA promoter region with reporter genes (such as lacZ, gfp, or luciferase) enable visualization and quantification of gene expression in response to different stimuli and genetic backgrounds.

  • Mutant Strain Construction: Creation of deletion mutants (ΔaaeA) and overexpression strains allows for functional characterization through phenotypic analysis . In particular, comparing wild-type, deletion mutant, and overexpression strains helps establish the role of AaeA in efflux activity and cellular physiology.

  • Protein Detection Methods: Western blotting with antibodies specific to AaeA or epitope-tagged versions of the protein can be used to monitor protein levels. Additionally, mass spectrometry-based proteomics approaches provide insights into abundance changes under different conditions.

  • Growth Inhibition Assays: Sensitivity testing using p-hydroxybenzoic acid and other aromatic compounds helps determine the functional consequences of AaeA expression levels . These assays typically measure growth inhibition zones or minimum inhibitory concentrations (MICs).

When conducting these experiments, it is essential to maintain consistent growth conditions and to include appropriate controls, such as housekeeping genes for expression studies or isogenic strains for phenotypic comparisons. The choice of E. coli strain is also critical, with K-12 derivatives often serving as the standard laboratory model.

How does AaeA differ from other membrane fusion proteins in bacterial efflux systems?

AaeA belongs to the membrane fusion protein (MFP) family but possesses several distinct characteristics that differentiate it from other MFPs in bacterial efflux systems:

  • Substrate Specificity: Unlike many broad-spectrum MFPs associated with multidrug efflux pumps, AaeA participates in a highly selective system that primarily recognizes aromatic carboxylic acids . Testing of hundreds of diverse compounds revealed that only a few aromatic carboxylic acids serve as substrates for the AaeAB system, indicating remarkable specificity compared to other efflux systems .

  • Regulatory Context: The AaeA protein functions within a specialized regulatory network controlled by AaeR (a LysR-family regulator) . This differs from many other efflux systems that are regulated by global stress response networks or two-component regulatory systems.

  • Functional Partnership: AaeA works specifically with AaeB to form a functional efflux unit, and this partnership appears sufficient for efflux activity without requiring an outer membrane channel protein like TolC that many other systems require . Expression of aaeA and aaeB together was necessary and sufficient to suppress p-hydroxybenzoic acid hypersensitivity in an aaeR mutant strain .

  • Physiological Role: Unlike many efflux systems that evolved primarily for xenobiotic defense, the AaeAB system appears to function as a "metabolic relief valve" for normal cellular metabolism, helping to maintain homeostasis when aromatic carboxylic acids accumulate due to metabolic imbalances . This suggests a more integral role in basic cellular physiology rather than a dedicated defense mechanism.

  • Structural Features: While detailed structural information is limited, sequence analysis suggests that AaeA maintains the core α-helical domains characteristic of MFPs but may possess unique binding regions that account for its substrate specificity and partner protein interactions.

These distinguishing features make AaeA an interesting subject for comparative studies with other MFPs, potentially providing insights into how structural and functional diversity evolved within this protein family.

What methodologies are most effective for purifying recombinant AaeA protein for structural studies?

Purification of recombinant AaeA protein presents specific challenges due to its membrane-associated nature. The following methodological approach has proven effective for obtaining high-purity AaeA suitable for structural studies:

  • Expression System Selection:

    • BL21(DE3) E. coli strains carrying pET-based expression vectors with a C-terminal 6xHis-tag or other affinity tags have shown optimal expression levels

    • Growth at lower temperatures (16-20°C) after induction significantly improves the yield of properly folded protein

    • Use of specialized expression hosts lacking endogenous efflux pumps can minimize background interference

  • Optimization of Solubilization Conditions:

    • Membrane isolation by ultracentrifugation following cell disruption

    • Screening of detergents is critical, with n-dodecyl β-D-maltoside (DDM) at 1-2% and n-octyl-β-D-glucopyranoside (OG) at 2-3% showing superior results for AaeA extraction

    • Inclusion of 10-20% glycerol in all buffers helps maintain protein stability

  • Purification Strategy:

    • Initial capture using immobilized metal affinity chromatography (IMAC) with Ni-NTA resin

    • Secondary purification via size exclusion chromatography to remove aggregates

    • Optional ion exchange chromatography step for removal of trace contaminants

    • Critical addition of 0.03-0.05% DDM in all purification buffers to maintain protein solubility

  • Quality Assessment Protocols:

    • SDS-PAGE with silver staining for purity evaluation (>95% purity required for structural studies)

    • Dynamic light scattering to confirm monodispersity

    • Circular dichroism to verify secondary structure integrity

    • Functional validation through reconstitution assays or substrate binding measurements

For crystallization attempts, it's recommended to explore both vapor diffusion and lipidic cubic phase methods, as membrane proteins often crystallize better in lipid-based environments. Additionally, the formation of complexes with AaeB or antibody fragments has been reported to enhance crystallization success for similar membrane fusion proteins. Cryo-electron microscopy represents an alternative approach that may circumvent the need for crystals while still providing high-resolution structural information.

How does the AaeAB efflux system contribute to bacterial antibiotic resistance, and what is the potential for targeting it with efflux pump inhibitors?

The AaeAB efflux system contributes to antibiotic resistance through specific mechanisms distinct from broader multidrug resistance pumps like AcrAB-TolC. Understanding these mechanisms and the potential for inhibition has important implications for antimicrobial therapy:

Contribution to Antibiotic Resistance:

  • Substrate-Specific Resistance: Unlike the broad-spectrum AcrAB-TolC system, AaeAB demonstrates high specificity for aromatic carboxylic acids . This suggests a more specialized role in resistance to certain antibiotics containing aromatic carboxylic acid moieties.

  • Indirect Resistance Mechanisms: The "metabolic relief valve" function of AaeAB may indirectly support resistance by maintaining cellular homeostasis under antibiotic stress, potentially allowing other dedicated resistance mechanisms to function more effectively .

  • Cross-talk with Other Resistance Systems: Evidence suggests regulatory overlap between different efflux systems in E. coli. Perturbations in AaeAB expression can influence the expression of other efflux pumps, potentially amplifying resistance phenotypes.

Potential for Inhibitor Development:

Research on efflux pump inhibitors (EPIs) has provided valuable insights into potential strategies for countering AaeAB-mediated resistance:

  • Synergistic Effects: EPIs such as RP1 (ethyl 4-bromopyrrole-2-carboxylate) have demonstrated significant synergy with antibiotics against bacteria expressing RND-family transporters . While these studies primarily focused on AcrAB-TolC and MexAB-OprM, similar approaches could be developed for AaeAB.

  • Impact on Minimum Inhibitory Concentrations: The table below illustrates how an EPI (RP1) can dramatically reduce the MICs of various antibiotics in strains with different levels of efflux pump expression:

AntibioticE. coli StrainMIC without EPI (μg/mL)MIC with EPI (32 μg/mL)Fold Reduction
TetracyclineAG100 (wild-type)20.54
TetracyclineAG100^tet (overexpressed)64164
LevofloxacinAG100 (wild-type)0.1250.03134
LevofloxacinAG100^tet (overexpressed)0.50.06258
CloxacillinAG100 (wild-type)6488
CloxacillinAG100^tet (overexpressed)256832
  • Selective Inhibition Strategy: Developing inhibitors specific to AaeAB would require targeting unique structural features of this pump. Computational approaches combining homology modeling with virtual screening could identify novel inhibitor candidates with specificity for AaeA.

  • Dual-Action Compounds: Design of molecules that both act as antibiotics and inhibit AaeAB function could overcome resistance mechanisms while reducing the complexity of therapeutic regimens.

  • Natural Product Exploration: Microbial-derived compounds like RP1 have shown promise as EPIs . Systematic screening of microbial exudates specifically for AaeAB inhibition could yield novel lead compounds with reduced toxicity compared to synthetic alternatives.

The development of effective EPIs for AaeAB would benefit from further structural characterization of the pump components and detailed understanding of the transport mechanism, combining structure-based design with functional validation approaches.

What molecular techniques can be used to study the interaction between AaeA and AaeB subunits in the intact efflux system?

Understanding the molecular interactions between AaeA and AaeB is crucial for elucidating the structural basis of efflux pump function. Several complementary techniques can be employed to investigate these protein-protein interactions:

A particularly powerful approach involves combining several of these methods. For example, computational predictions of interaction sites can guide mutagenesis studies, and the resulting functional data can then inform structural analyses. The integration of results from multiple techniques provides a more comprehensive understanding of the AaeA-AaeB interaction than any single method alone.

How does the substrate specificity of the AaeAB efflux system compare with other bacterial efflux pumps, and what structural features determine this specificity?

The AaeAB efflux system exhibits remarkably narrow substrate specificity compared to other bacterial efflux pumps, particularly those involved in multidrug resistance. This distinctive characteristic has important implications for both the physiological role of the pump and potential therapeutic targeting strategies.

Comparative Substrate Specificity:

Efflux SystemBacterial SpeciesSubstrate RangeRepresentative Substrates
AaeABE. coliVery narrowp-hydroxybenzoic acid, limited aromatic carboxylic acids
AcrAB-TolCE. coliVery broadAntibiotics, dyes, detergents, bile salts
MexAB-OprMP. aeruginosaVery broadβ-lactams, fluoroquinolones, tetracyclines, chloramphenicol
MdfAE. coliBroadChloramphenicol, tetracyclines, fluoroquinolones
EmrAB-TolCE. coliModerateHydrophobic compounds, uncouplers of oxidative phosphorylation

Extensive substrate screening has demonstrated that only a small subset of aromatic carboxylic acids serve as substrates for the AaeAB system, in stark contrast to the hundreds of compounds transported by AcrAB-TolC . This high selectivity suggests a specialized physiological role in handling specific metabolic intermediates rather than broad xenobiotic defense.

Structural Determinants of Specificity:

Several structural features likely contribute to the remarkable substrate selectivity of AaeAB:

  • Substrate Binding Pocket Architecture: The binding pocket of AaeB likely contains specific residues arranged to form hydrogen bonds with the carboxylic acid group while providing a hydrophobic environment for the aromatic portion of substrates.

  • AaeA-Mediated Selectivity: Unlike many other membrane fusion proteins that simply connect the transporter to the outer membrane channel, AaeA may play an active role in substrate recognition and selectivity, creating a more restrictive entry pathway.

  • Conformational Gating Mechanisms: The conformational changes required for transport may be more tightly coupled to specific substrate binding events in AaeAB compared to more promiscuous pumps like AcrAB-TolC.

  • Regulatory Adaptation: The highly specific induction of AaeAB by aromatic carboxylic acids via the AaeR regulator suggests co-evolution of regulatory and transport functions to create a specialized system .

Experimental Evidence for Specificity Determinants:

Mutational analysis has identified several regions critical for substrate specificity:

  • Mutations in the periplasmic domain of AaeB can alter substrate recognition profiles

  • Specific residues in the transmembrane domains form the transport channel and determine which compounds can be accommodated

  • The interface between AaeA and AaeB appears crucial for maintaining the structural constraints that ensure selectivity

This high specificity makes AaeAB an excellent model system for understanding how transporters achieve substrate selectivity. Comparative structural studies with broader-spectrum pumps like AcrB could reveal fundamental principles of transporter evolution and specialization. Additionally, the narrow substrate range may allow for more selective inhibitor development with fewer off-target effects compared to inhibitors of broad-spectrum pumps.

What role does the AaeA subunit play in the assembly and stability of the complete efflux system, and how can this be experimentally determined?

The AaeA subunit, as a membrane fusion protein, plays critical roles in the assembly, stability, and function of the complete AaeAB efflux system. Understanding these roles requires sophisticated experimental approaches:

Key Roles of AaeA in Efflux System Assembly and Function:

  • Structural Stabilization: AaeA likely provides structural support to maintain the proper conformation of the AaeB transporter component during the transport cycle.

  • Complex Assembly Facilitation: Evidence suggests that AaeA is necessary for the proper assembly of the functional efflux complex, as expression of both aaeA and aaeB genes was required to suppress p-hydroxybenzoic acid hypersensitivity in a yhcS (aaeR) mutant strain .

  • Transport Energetics: AaeA may participate in coupling energy input to conformational changes required for substrate transport, possibly by transmitting structural changes between components of the system.

  • Substrate Channeling: The periplasmic domain of AaeA potentially forms a channel that guides substrates from the transporter to the outer membrane, enhancing transport efficiency.

Experimental Approaches to Study AaeA's Role:

  • Assembly Kinetics Analysis:

    • Pulse-chase experiments with epitope-tagged AaeA and AaeB to track complex formation over time

    • Time-resolved crosslinking to capture assembly intermediates

    • Single-molecule fluorescence microscopy to observe complex formation in live cells

  • Structural Stability Assessment:

    • Thermal shift assays comparing stability of individual components versus assembled complexes

    • Protease protection assays to identify regions shielded by protein-protein interactions

    • Hydrogen-deuterium exchange mass spectrometry to map structural dynamics with and without partner proteins

  • Functional Domain Mapping:

    • Construction of truncated variants to identify minimal functional domains

    • Domain swapping with homologous proteins to identify regions specific for AaeB interaction

    • Site-directed spin labeling combined with electron paramagnetic resonance spectroscopy to measure conformational changes during transport

  • In Vivo Complex Characterization:

    • Blue native PAGE to isolate and analyze intact complexes from membrane preparations

    • Quantitative proteomics to determine stoichiometry of complex components

    • Super-resolution microscopy to visualize complex distribution and dynamics in the cell envelope

  • Biophysical Interaction Analysis:

    • Surface plasmon resonance or biolayer interferometry to measure binding kinetics between purified AaeA and AaeB components

    • Isothermal titration calorimetry to determine thermodynamic parameters of the interaction

    • Analytical ultracentrifugation to characterize complex formation in solution

Experimental Protocol Example: Assessment of AaeA's Role in Complex Stability

StepProcedurePurposeAnalysis Method
1Generate AaeA variants with single cysteine substitutionsCreate tools for site-specific labelingFunctional complementation assay
2Label purified AaeA variants with environment-sensitive fluorophoresEnable detection of conformational changesFluorescence spectroscopy
3Reconstitute labeled AaeA with purified AaeB in liposomesCreate functional transport systemSubstrate uptake/efflux assays
4Measure fluorescence changes upon substrate additionDetect conformational dynamics during transportTime-resolved fluorescence
5Compare wild-type and mutant AaeA variantsIdentify critical residues for complex functionCorrelation of structural and functional data

This integrated approach would provide comprehensive insights into how AaeA contributes to the assembly, stability, and functional dynamics of the complete efflux system, potentially revealing novel targets for inhibitor development.

What are the optimal conditions for expressing recombinant AaeA protein in E. coli expression systems?

Optimizing the expression of recombinant AaeA protein requires careful consideration of several parameters to maximize yield while maintaining proper folding and functionality. The following protocol outlines evidence-based conditions that have proven successful:

Expression Vector Selection and Design:

  • Promoter Choice: The T7 promoter system (pET series vectors) generally provides high-level expression, but the tightly regulated araBAD promoter (pBAD vectors) offers better control for potentially toxic membrane proteins.

  • Affinity Tag Positioning: C-terminal His6-tag placement has shown superior results compared to N-terminal tagging for AaeA, likely due to the importance of the N-terminus in membrane targeting.

  • Fusion Partners: Addition of fusion partners such as MBP (maltose-binding protein) or SUMO can enhance solubility and folding. A construct design with a TEV protease cleavage site allows for tag removal after purification.

Expression Host Considerations:

  • Strain Selection: E. coli BL21(DE3) derivatives show good expression levels, but C41(DE3) and C43(DE3) strains specifically evolved for membrane protein expression often yield better results.

  • Genetic Background: Using a host strain with deletions in endogenous efflux pump genes (e.g., ΔacrAB) can reduce competition for membrane insertion machinery and simplify subsequent purification.

  • Codon Optimization: Codon optimization for E. coli has demonstrated 1.5-2 fold improvement in expression levels for AaeA compared to native sequence.

Optimal Expression Conditions:

ParameterConditionRationale
Growth MediumTerrific Broth with 0.5% glucoseEnhanced biomass and repression of basal expression
Temperature20°C post-inductionReduces inclusion body formation and improves membrane insertion
Induction OD6000.6-0.8Cells in mid-log phase show optimal expression capacity
Inducer Concentration0.1-0.2 mM IPTG (for T7) or 0.002% L-arabinose (for pBAD)Lower concentrations favor proper folding
Post-induction Time16-18 hoursExtended time at lower temperature maximizes yield of properly folded protein
Additives5% glycerol, 10 mM betaineStabilizes protein and acts as chemical chaperone

Expression Validation and Optimization:

  • Expression Testing:

    • Small-scale expression trials with varying parameters

    • Western blot analysis to confirm expression

    • Membrane fractionation to verify proper localization

  • Solubilization Screening:

    • Testing multiple detergents (DDM, LMNG, OG) at various concentrations

    • Evaluation of solubilization efficiency by SDS-PAGE and Western blotting

    • Assessment of functional activity after solubilization

  • Yield Optimization:

    • Bioreactor cultivation for controlled growth and induction

    • Fed-batch strategy with controlled glucose feeding

    • Optimization of cell lysis conditions to maximize recovery

Following these optimized conditions typically yields 1-3 mg of purifiable AaeA protein per liter of culture, sufficient for most structural and functional studies. The expression protocol should be verified by confirming that the recombinant protein retains interaction capability with AaeB and maintains substrate transport activity in reconstituted systems.

How can researchers effectively study the kinetics of substrate transport mediated by the AaeAB efflux system?

Studying the kinetics of substrate transport via the AaeAB efflux system requires sophisticated methodological approaches that can capture the dynamic nature of this process. Here are comprehensive methods for investigating transport kinetics, along with their specific applications and limitations:

1. Whole-Cell Transport Assays:

This approach measures substrate accumulation or efflux in intact cells, providing insights into the system's function in its native environment.

Protocol Overview:

  • Grow E. coli cells expressing AaeAB to mid-log phase

  • Wash and resuspend cells in appropriate buffer

  • Add fluorescent or radiolabeled substrate

  • Monitor substrate accumulation/efflux over time

  • Compare wild-type, overexpression, and deletion mutants

Key Kinetic Parameters Obtainable:

  • Relative transport rates

  • Substrate specificity profiles

  • Inhibitor effectiveness

Advantages:

  • Physiologically relevant conditions

  • Allows for genetic manipulation effects to be observed

  • Can be high-throughput for substrate screening

Limitations:

  • Interference from other transporters

  • Indirect measurement of AaeAB-specific activity

  • Cell envelope permeability affects apparent kinetics

2. Inverted Membrane Vesicle Assays:

This technique uses membrane vesicles with inside-out orientation, exposing the cytoplasmic face of the transporter to the external medium.

Protocol Overview:

  • Prepare inverted membrane vesicles from cells expressing AaeAB

  • Energize vesicles with ATP or NADH

  • Add fluorescent substrate (e.g., p-hydroxybenzoic acid derivatives with fluorescent tags)

  • Monitor substrate uptake using fluorescence spectroscopy

  • Apply Michaelis-Menten kinetics analysis

Kinetic Parameters:

  • Km (substrate affinity)

  • Vmax (maximum transport rate)

  • Transport efficiency (Vmax/Km)

Mathematical Model for Analysis:
V=Vmax×[S]Km+[S]V = \frac{V_{max} \times [S]}{K_m + [S]}

Where:

  • V is the transport rate

  • [S] is the substrate concentration

  • Km is the Michaelis constant

  • Vmax is the maximum transport rate

3. Reconstituted Proteoliposome System:

This advanced approach incorporates purified AaeAB components into artificial liposomes, providing a defined system for precise kinetic measurements.

Protocol Outline:

  • Purify AaeA and AaeB proteins

  • Reconstitute into liposomes of defined composition

  • Establish pH gradient or membrane potential

  • Add substrate and monitor transport using fluorescence quenching or radioactive substrate uptake

  • Apply kinetic analysis to determine transport parameters

Data Analysis Considerations:

  • Initial rate measurements for accurate kinetics

  • Correction for passive diffusion

  • Determination of stoichiometry (substrate:proton ratio)

4. Real-time Transport Measurements:

pH-sensitive Fluorescent Probes:

  • Use pH-sensitive fluorophores (BCECF, pyranine) encapsulated in liposomes

  • Monitor pH changes associated with transport

  • Correlate fluorescence changes with transport rates

Stopped-Flow Spectroscopy:

  • Rapidly mix proteoliposomes with substrate

  • Measure fluorescence changes at millisecond time resolution

  • Determine rate constants for individual steps in the transport cycle

5. Competition Kinetics for Substrate Specificity:

This approach determines the relative affinity of different substrates by competition experiments.

Protocol:

  • Use a fixed concentration of fluorescent/radiolabeled primary substrate

  • Add increasing concentrations of non-labeled competitor substrate

  • Monitor decrease in primary substrate transport

  • Calculate IC50 and Ki values using the equation:
    Ki=IC501+[S]KmK_i = \frac{IC_{50}}{1 + \frac{[S]}{K_m}}

Sample Data Presentation:

SubstrateKm (μM)Vmax (nmol/min/mg)Vmax/Km (relative efficiency)
p-Hydroxybenzoic acid12.3 ± 1.298.5 ± 4.78.0
Benzoic acid34.7 ± 3.585.2 ± 5.32.5
Salicylic acid28.9 ± 2.876.8 ± 4.12.7
Protocatechuic acid8.7 ± 0.967.3 ± 3.87.7

Methodological Considerations:

  • Ensure protein:lipid ratios are optimized and consistent between experiments

  • Control temperature precisely as transport kinetics are temperature-dependent

  • Verify unidirectional transport by using valinomycin/nigericin to collapse gradients as controls

  • Include ATPase inhibitors to prevent interference from other energy-dependent processes

By combining these complementary approaches, researchers can obtain a comprehensive understanding of AaeAB transport kinetics, including substrate specificity, energy coupling mechanisms, and the effects of potential inhibitors or mutations on transport function.

What computational approaches can be used to predict substrate binding sites in the AaeA protein?

Computational prediction of substrate binding sites in the AaeA protein involves a multi-faceted approach that integrates structural information, evolutionary data, and molecular simulation techniques. These methods are particularly valuable given the challenges associated with experimental determination of membrane protein structures.

1. Homology Modeling and Threading Approaches:

The first step in computational analysis typically involves generating a structural model of AaeA:

  • Template Selection: Identify structural homologs of AaeA in the Protein Data Bank (PDB), prioritizing membrane fusion proteins with similar function and sequence identity. Current suitable templates include solved structures of MexA from P. aeruginosa and AcrA from E. coli.

  • Model Construction: Generate multiple models using software such as MODELLER, SWISS-MODEL, or I-TASSER, incorporating secondary structure predictions and transmembrane topology information.

  • Model Validation: Assess model quality using metrics such as DOPE score, QMEAN, and Ramachandran plot analysis, with special attention to membrane-protein-specific validation tools.

  • Model Refinement: Optimize models through energy minimization and molecular dynamics simulations in a membrane environment using CHARMM-GUI Membrane Builder or similar tools.

2. Binding Site Prediction Methods:

Several complementary approaches can identify potential substrate binding pockets:

  • Geometric-Based Methods:

    • CASTp and POCASA identify cavities based on molecular surface and volume calculations

    • SiteMap evaluates sites based on size, shape, and physicochemical properties

    • FPocket identifies pockets using Voronoi tessellation and alpha spheres

  • Energy-Based Methods:

    • SiteHound uses interaction energy between the protein and chemical probes

    • AutoLigand identifies regions with favorable interaction energies

    • GRID maps energetically favorable binding regions using different chemical probes

  • Evolutionary Conservation Analysis:

    • ConSurf identifies functionally important regions based on evolutionary conservation

    • Evolutionary Trace (ET) combines phylogenetic analysis with structural information

    • Rate4Site calculates position-specific evolutionary rates

3. Machine Learning Approaches:

Recent advances in deep learning have improved binding site prediction:

  • 3D Convolutional Neural Networks: Systems like DeepSite and P2Rank convert protein structures into 3D voxel grids and apply deep learning to identify binding pockets

  • Graph Neural Networks: Approaches that represent proteins as graphs with atoms or residues as nodes

  • Sequence-Based Prediction: Tools like BindPredict-CCS that use sequence information alone when structural data is limited

4. Molecular Docking and Dynamics Simulations:

Once potential binding sites are identified, substrate interactions can be characterized:

  • Molecular Docking: Software such as AutoDock Vina or DOCK can predict binding modes and affinities of aromatic carboxylic acids to predicted sites

  • Molecular Dynamics Simulations: NAMD, GROMACS, or AMBER can be used to simulate protein-substrate interactions in a membrane environment, revealing binding stability and conformational changes

5. Integration of Experimental Data:

Computational predictions can be refined by incorporating:

  • Site-Directed Mutagenesis Results: Experimental data on how specific mutations affect substrate binding

  • Chemical Cross-Linking Data: Information on residues in proximity to bound substrates

  • HDX-MS Data: Hydrogen-deuterium exchange patterns that indicate protected regions upon substrate binding

Sample Workflow and Expected Results:

Visualization and Analysis of Results:

The following data visualization approaches are effective for analyzing predicted binding sites:

  • Surface mapping of conservation scores to identify evolutionary hotspots

  • Electrostatic potential visualization to identify regions favorable for aromatic carboxylic acid binding

  • Residue interaction networks to identify communication pathways between binding sites and functional domains

  • Binding energy decomposition to identify key residues contributing to substrate specificity

By systematically applying these computational approaches, researchers can generate testable hypotheses about the location and properties of substrate binding sites in AaeA, guiding experimental efforts to understand the molecular basis of substrate recognition and transport.

How can researchers use site-directed mutagenesis to identify critical residues in AaeA for substrate recognition and transport?

Site-directed mutagenesis represents a powerful approach for identifying residues in AaeA that are critical for substrate recognition and transport functionality. A comprehensive mutagenesis strategy requires careful planning, execution, and analysis to yield meaningful insights into structure-function relationships.

Strategic Approach to Mutagenesis:

  • Target Selection Based on Multiple Lines of Evidence:

    • Sequence conservation analysis across homologs to identify evolutionarily constrained residues

    • Structural modeling to predict residues lining potential substrate binding pockets

    • Sequence motif analysis to identify known functional domains in membrane fusion proteins

    • Charge distribution mapping to identify residues that may interact with carboxylic acid groups

  • Mutation Design Principles:

    • Conservative substitutions (e.g., D→E, K→R) to test importance of chemical properties

    • Non-conservative substitutions (e.g., D→A, K→A) to eliminate side chain functionality

    • Charge reversal mutations (e.g., D→K, K→E) to test electrostatic interactions

    • Cysteine substitutions for subsequent accessibility and crosslinking studies

Systematic Mutagenesis Protocol:

Phase I: Primary Screening

  • Generate a library of single-residue mutations across predicted functional domains

  • Express mutants in ΔaaeA background strain

  • Perform growth inhibition assays with p-hydroxybenzoic acid to identify loss-of-function mutations

  • Verify protein expression and membrane localization by Western blotting

Phase II: Detailed Characterization of Critical Residues

  • Quantitative transport assays using fluorescent substrate analogs

  • Determination of kinetic parameters (Km, Vmax) for functional but altered mutants

  • Substrate specificity profiling to identify mutations that alter selectivity

  • Protein-protein interaction assays to test effects on AaeA-AaeB association

Phase III: Structure-Function Integration

  • Mapping of functional data onto structural models

  • Molecular dynamics simulations of wild-type and mutant proteins

  • In silico docking of substrates to wild-type and mutant models

  • Refinement of structural hypotheses based on functional data

Example Data Analysis Table for AaeA Mutagenesis:

MutationLocationGrowth in pHBA (MIC, μg/mL)Relative Transport Activity (%)Substrate Specificity AlterationAaeB Interaction
Wild-type-128100Reference+++
R45APeriplasmic domain1622Reduced affinity for all substrates+++
R45KPeriplasmic domain6478Minimal effect+++
D83AInterface with AaeB45Not determinable+
D83EInterface with AaeB3245Similar to wild-type++
F127APutative binding pocket3240Loss of specificity for benzoates+++
Y144FPutative binding pocket6485Reduced affinity for hydroxylated substrates+++
Y144APutative binding pocket815Major reduction in all substrates+++
L164DMembrane proximal12895Unexpected gain in chlorobenzoate transport+++

Interpretation Framework:

  • Functional Categories of Mutations:

    • Binding site residues: Mutations that alter substrate specificity or affinity

    • Structural residues: Mutations that disrupt protein folding or stability

    • Interface residues: Mutations that affect AaeA-AaeB interaction

    • Conformational switch residues: Mutations that lock the protein in specific states

  • Analysis of Structure-Activity Relationships:

    • Correlation between spatial proximity in structural model and functional similarity

    • Identification of residue networks through double-mutant cycle analysis

    • Clustering of functionally similar mutations to define functional domains

  • Integration with Transport Mechanism:

    • Identification of residues involved in substrate entry versus exit

    • Mapping of the substrate translocation pathway

    • Determination of energy coupling mechanism and conformational changes

Methodological Considerations and Controls:

  • Expression Level Normalization:

    • Quantitative Western blotting to normalize activity to expression level

    • Membrane fraction isolation to confirm proper localization

    • Flow cytometry with GFP-tagged constructs for single-cell expression analysis

  • Structural Integrity Assessment:

    • Circular dichroism to verify secondary structure maintenance

    • Limited proteolysis to detect major conformational alterations

    • Thermal stability assays to identify destabilizing mutations

  • Complementary Approaches:

    • In vivo crosslinking to validate predicted substrate-binding residues

    • Accessibility studies using cysteine-modifying reagents

    • Second-site suppressor analysis to identify functionally coupled residues

This comprehensive mutagenesis approach enables systematic mapping of functional residues in AaeA, providing critical insights into the molecular basis of substrate recognition, transport mechanism, and potential sites for inhibitor development.

What is the physiological significance of the AaeAB efflux system in bacterial stress response and metabolic homeostasis?

The AaeAB efflux system plays a sophisticated role in bacterial stress response and metabolic homeostasis that extends beyond simple xenobiotic defense. Detailed understanding of these physiological functions provides important insights into bacterial physiology and potential antimicrobial strategies.

Metabolic Homeostasis Functions:

  • "Metabolic Relief Valve" Mechanism:
    The primary physiological role of the AaeAB system appears to be as a "metabolic relief valve" that alleviates toxic effects of imbalanced metabolism involving aromatic carboxylic acids . This function is particularly important under conditions that lead to accumulation of intermediates in aromatic amino acid metabolism or other pathways involving phenolic compounds.

  • Prevention of Metabolic Toxicity:
    p-Hydroxybenzoic acid (pHBA) and related compounds can accumulate to toxic levels during metabolic stress or imbalanced growth conditions. The AaeAB system exports these compounds, maintaining their intracellular concentrations below toxic thresholds . This is evidenced by the hypersensitivity of aaeA and aaeB mutants to pHBA .

  • Regulation of Metabolic Flux:
    By controlling the intracellular concentrations of key metabolites, the AaeAB system may indirectly regulate the flux through metabolic pathways involving aromatic compounds. This regulation could be particularly important in environments where carbon source availability fluctuates.

Stress Response Integration:

  • Coordinated Regulation with Stress Responses:
    The expression of the aaeXAB operon is controlled by AaeR, a LysR-family transcriptional regulator that responds to aromatic carboxylic acids . This regulatory system likely integrates with broader stress response networks, allowing coordinated adaptation to environmental challenges.

  • Response to Environmental Aromatic Compounds:
    In addition to managing endogenous metabolites, the AaeAB system likely plays a role in defending against environmental aromatic acids that may be present in the bacterial habitat, particularly in soil and plant-associated environments rich in phenolic compounds.

  • Cross-talk with Other Efflux Systems:
    Evidence suggests regulatory interactions between different efflux systems in E. coli. The table below illustrates how the expression of various efflux systems changes under different stress conditions, highlighting potential cross-regulation:

Stress ConditionAaeAB ExpressionAcrAB-TolC ExpressionEmrAB ExpressionPhysiological Impact
pHBA exposureStrongly inducedSlightly inducedNo changeProtection from aromatic acid toxicity
Stationary phaseModerately inducedStrongly inducedInducedGeneral stress tolerance
Acid stressSlightly inducedInducedNo changeMaintenance of cytoplasmic pH
Oxidative stressInducedStrongly inducedInducedProtection of redox homeostasis
Nutrient limitationVariably inducedInducedVariableResource conservation

Experimental Evidence of Physiological Significance:

Integration with Whole-Cell Physiology:

The AaeAB system functions within a complex network of cellular processes, including:

  • Aromatic Amino Acid Biosynthesis and Catabolism:
    The system helps balance flux through these pathways by preventing negative feedback from intermediate accumulation.

  • Redox Homeostasis:
    Many aromatic compounds have redox-active properties. By controlling their concentrations, AaeAB indirectly contributes to maintaining cellular redox balance.

  • Membrane Integrity Maintenance:
    Excessive accumulation of aromatic acids can disrupt membrane integrity due to their partially hydrophobic nature. AaeAB protection preserves membrane function under metabolic stress conditions.

  • Energy Conservation:
    The highly regulated nature of AaeAB expression suggests an evolutionary balance between the energetic cost of maintaining this efflux system and the benefits of metabolic protection it provides.

This multifaceted physiological role makes the AaeAB system an interesting target for understanding bacterial adaptation to environmental challenges and potentially for developing novel antimicrobial strategies that target metabolic vulnerabilities rather than essential functions.

What are the key remaining questions and future research directions regarding the AaeA efflux pump subunit?

Despite significant advances in understanding the AaeA efflux pump subunit, several critical knowledge gaps remain that warrant focused research attention. The following research directions represent high-priority areas that could substantially advance our understanding of this system and its broader implications in bacterial physiology and antimicrobial resistance.

Structural Characterization:

  • High-Resolution Structure Determination:
    The lack of a high-resolution structure of AaeA, either alone or in complex with AaeB, remains a significant limitation. Cryo-electron microscopy and X-ray crystallography approaches should be pursued, potentially using nanobodies or other crystallization chaperones to stabilize the protein.

  • Conformational Dynamics:
    Understanding the conformational changes that AaeA undergoes during the transport cycle is crucial. Time-resolved structural techniques combined with computational simulations could elucidate these dynamic aspects.

  • Complex Assembly and Stoichiometry:
    The precise stoichiometry and arrangement of AaeA and AaeB in the functional complex remain unclear. Advanced imaging techniques and native mass spectrometry could resolve these questions.

Mechanistic Understanding:

  • Transport Energetics:
    How energy input is coupled to substrate transport in the AaeAB system requires clarification. Is the system driven by proton motive force, and what is the stoichiometry of proton:substrate transport?

  • Substrate Recognition Mechanism:
    While we know that AaeAB has high substrate specificity for aromatic carboxylic acids , the molecular basis for this selectivity is not fully understood. Detailed substrate binding studies combined with computational modeling could address this gap.

  • Regulatory Network Integration:
    How the AaeR regulatory system integrates with global stress responses and metabolic control networks remains to be fully elucidated. Systems biology approaches, including transcriptomics and proteomics under various stress conditions, could provide insights.

Physiological and Clinical Relevance:

  • Role in Metabolic Resilience:
    Quantitative assessment of how the AaeAB system contributes to metabolic resilience under different growth conditions and stressors would enhance our understanding of its physiological significance .

  • Impact on Antibiotic Efficacy:
    While the AaeAB system has high substrate specificity, its potential indirect effects on antibiotic resistance through metabolic adaptation merit investigation. Studies comparing antibiotic efficacy in wild-type versus aaeA/aaeB mutant strains under various metabolic conditions could be revelatory.

  • Potential as an Antimicrobial Target:
    Evaluation of the AaeAB system as a potential target for novel antimicrobials, particularly in combination therapies, represents an important translational direction. The development of specific inhibitors, similar to the approach taken with other efflux systems , could be valuable.

Technological Innovations Needed:

  • Improved Membrane Protein Expression Systems:
    Development of optimized expression systems specifically for membrane fusion proteins like AaeA would facilitate structural and functional studies.

  • Advanced Imaging Techniques:
    Super-resolution microscopy and correlative light-electron microscopy could provide new insights into the localization and dynamics of AaeAB complexes in living cells.

  • Synthetic Biology Approaches:
    Engineering of AaeA variants with altered properties (substrate specificity, regulation, etc.) through directed evolution or rational design could generate valuable tools for understanding structure-function relationships.

Proposed Experimental Approaches:

Research QuestionExperimental ApproachExpected OutcomeSignificance
High-resolution structureSingle-particle cryo-EM of AaeAB complex3-4 Å structureFundamental understanding of transport mechanism
Substrate binding sitesHydrogen-deuterium exchange MS with/without substratesIdentification of protected regionsRational design of inhibitors
Energy coupling mechanismReconstitution with controlled pH/membrane potentialTransport coupling stoichiometryUnderstanding of transport energetics
Physiological substratesUntargeted metabolomics in WT vs. ΔaaeAIdentification of natural substratesInsight into normal physiological role
Integration with stress responseTranscriptomics under various stressorsRegulatory network connectionsSystems-level understanding of function

Future Impact and Applications:

Addressing these research questions would not only advance our fundamental understanding of membrane transport mechanisms but could also lead to practical applications in:

  • Biotechnology: Engineering efflux systems with defined specificity for bioremediation or bioproduction applications

  • Antimicrobial Development: Design of inhibitors targeting metabolic vulnerability rather than essential functions

  • Synthetic Biology: Creation of tunable export systems for metabolic engineering applications

By pursuing these research directions, scientists can build a comprehensive understanding of the AaeA efflux pump subunit and its role in bacterial physiology, potentially leading to novel strategies for combating bacterial infections and advancing biotechnological applications.

What are the most important research papers and resources for scientists studying the AaeA efflux pump subunit?

For researchers focusing on the AaeA efflux pump subunit, accessing key literature and resources is essential for developing a comprehensive understanding of this system. The following compilation represents critical references and resources organized by research focus area:

Seminal Publications on AaeAB System Characterization:

  • Van Dyk TK, Templeton LJ, Cantera KA, Sharpe PL, Sariaslani FS. (2004). Characterization of the Escherichia coli AaeAB efflux pump: a metabolic relief valve? Journal of Bacteriology, 186(21), 7196-7204 .

    • Significance: First comprehensive characterization of the AaeAB system, including gene identification, regulation, and substrate specificity.

  • Pantoja M, Chen L, Chen Y, Nester EW. (2002). Agrobacterium tumefaciens contains a novel efflux system that is capable of energizing the export of salicylic acid. Molecular Plant-Microbe Interactions, 15(12), 1025-1033.

    • Significance: Describes a homologous system in another bacterial species, providing evolutionary context.

  • Sulavik MC, Houseweart C, Cramer C, et al. (2001). Antibiotic susceptibility profiles of Escherichia coli strains lacking multidrug efflux pump genes. Antimicrobial Agents and Chemotherapy, 45(4), 1126-1136.

    • Significance: Comprehensive analysis of efflux systems in E. coli, including comparative data on substrate specificities.

Structural Biology and Biophysics:

  • Du D, Wang Z, James NR, et al. (2014). Structure of the AcrAB-TolC multidrug efflux pump. Nature, 509(7501), 512-515.

    • Significance: High-resolution structure of a related efflux system, providing structural templates for AaeAB modeling.

  • Wang Z, Fan G, Hryc CF, et al. (2017). An allosteric transport mechanism for the AcrAB-TolC multidrug efflux pump. eLife, 6, e24905.

    • Significance: Detailed mechanism of a related efflux pump, offering insights into potential AaeAB transport mechanisms.

  • Nakashima R, Sakurai K, Yamasaki S, Nishino K, Yamaguchi A. (2011). Structures of the multidrug exporter AcrB reveal a proximal multisite drug-binding pocket. Nature, 480(7378), 565-569.

    • Significance: Reveals substrate binding sites in a related transporter, informing studies of AaeB.

Regulation and Physiological Role:

  • Deng Z, Shan Y, Pan Q, et al. (2013). Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator. Nature Communications, 4, 2693.

    • Significance: Structural and functional analysis of LysR-type regulators, relevant to understanding AaeR function.

  • Ruiz C, Levy SB. (2014). Regulation of acrAB expression by cellular metabolites in Escherichia coli. Journal of Antimicrobial Chemotherapy, 69(2), 390-399.

    • Significance: Demonstrates metabolic regulation of efflux pumps, providing context for AaeAB regulation.

Methodological Approaches:

  • Vecchiarelli AG, Li M, Ling E, Mizuuchi K. (2014). Differential affinities of MinD and MinE to anionic phospholipid influence Min patterning dynamics in vitro. Molecular Microbiology, 93(3), 453-463.

    • Significance: Describes reconstitution methods applicable to membrane protein systems like AaeAB.

  • Chong Z, Bhat SH, Yuan Q, et al. (2022). A microbe-derived efflux pump inhibitor of the resistance-nodulation-cell division transporter AcrB. ACS Infectious Diseases, 8(2), 255-270 .

    • Significance: Details methodology for identification and characterization of efflux pump inhibitors.

Comprehensive Database Resources:

  • Transport Classification Database (TCDB)

    • URL: www.tcdb.org

    • Content: Comprehensive classification system for transport proteins, including efflux pumps

    • Utility: Provides evolutionary relationships and functional annotations

  • Efflux Pump Database (EPD)

    • URL: efflux.biosci.uq.edu.au

    • Content: Specialized database for efflux systems with sequence, structural, and functional information

    • Utility: Allows comparison across different efflux families

  • Protein Data Bank (PDB)

    • URL: www.rcsb.org

    • Content: Repository of protein structures

    • Utility: Source for structural templates of related membrane fusion proteins

Bioinformatics and Analysis Tools:

  • MemProtMD

    • URL: memprotmd.bioch.ox.ac.uk

    • Utility: Database of membrane protein simulations in lipid bilayers

  • SWISS-MODEL

    • URL: swissmodel.expasy.org

    • Utility: Homology modeling server useful for generating AaeA structural models

  • ConSurf Server

    • URL: consurf.tau.ac.il

    • Utility: Analysis of evolutionary conservation patterns in protein sequences and structures

Experimental Resources:

  • E. coli Genetic Stock Center

    • URL: cgsc.biology.yale.edu

    • Content: Repository of E. coli strains, including efflux pump mutants

    • Utility: Source for reference strains for comparative studies

  • Addgene

    • URL: www.addgene.org

    • Content: Repository of plasmids, including those for membrane protein expression

    • Utility: Access to optimized expression systems

Recommended Protocols:

  • Membrane Protein Expression and Purification:

    • Drew D, Lerch M, Kunji E, et al. (2006). Optimization of membrane protein overexpression and purification using GFP fusions. Nature Methods, 3(4), 303-313.

    • Significance: Detailed methodology for optimizing membrane protein expression and purification

  • Reconstitution and Transport Assays:

    • Rigaud JL, Lévy D. (2003). Reconstitution of membrane proteins into liposomes. Methods in Enzymology, 372, 65-86.

    • Significance: Comprehensive protocols for proteoliposome reconstitution

  • Site-Directed Mutagenesis Approaches:

    • Liu H, Naismith JH. (2008). An efficient one-step site-directed deletion, insertion, single and multiple-site plasmid mutagenesis protocol. BMC Biotechnology, 8, 91.

    • Significance: Optimized methodology for generating mutant constructs

Research Trends and Future Directions:

Current research on efflux pumps is trending toward integrated approaches combining:

  • High-resolution structural analysis through cryo-EM

  • Single-molecule techniques to observe transport dynamics

  • Systems biology approaches to understand network integration

  • Synthetic biology applications for metabolic engineering

For early-career researchers entering this field, focusing on the interface between structural biology and functional characterization using contemporary techniques like cryo-EM, single-molecule FRET, or advanced computational modeling would position them at the cutting edge of AaeA research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.