Recombinant Escherichia coli O8 Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Description

Introduction to Phosphoglycerol Transferase I (mdoB)

Phosphoglycerol transferase I (mdoB), encoded by the mdoB gene in Escherichia coli, is a membrane-associated enzyme critical for the biosynthesis of membrane-derived oligosaccharides (MDO). These MDOs are periplasmic components involved in osmoregulation and phospholipid metabolism . Recombinant expression of mdoB enables large-scale production for functional and structural studies, with E. coli O8 serotype strains being a common host due to their genetic stability and compatibility with industrial enzyme production .

Gene and Protein Features

  • Gene Locus: mdoB (synonyms: opgB, yjjO) is located at 99.2 min on the E. coli chromosome .

  • Protein: mdoB is a 763-amino-acid transmembrane protein (UniProt ID: Q0T8V3) with a molecular weight of ~86 kDa .

  • Catalytic Activity: Transfers sn-1-phosphoglycerol residues from phosphatidylglycerol to MDO or artificial substrates like arbutin (EC 2.7.8.20) .

Table 1: Key Genetic and Expression Data

ParameterDetailsSource
Host SystemsE. coli, Yeast, Baculovirus, Mammalian Cells
Purity≥85% (SDS-PAGE)
Gene Length2,289 bp
Recombinant TagsN-terminal His-tag (common for purification)

In Vitro and In Vivo Activity

  • Substrate Specificity: Utilizes phosphatidylglycerol as a donor for phosphoglycerol transfer to MDO or β-glucosides like arbutin .

  • Mutant Studies: mdoB mutants (e.g., mdoB::Tn10) lack phosphoglycerol transferase activity, resulting in MDO devoid of phosphoglycerol residues .

Table 2: MDO Composition in Wild-Type vs. mdoB Mutants

StrainPhosphoglycerol Residues (mol P-GRO/mol MDO)Activity (nmol/h/mg protein)
Wild-Type (AB1133)2.06.0
mdoB::Tn10 (PT227)0.05<0.09
mdoB1 (NFB114)0.06<0.05
Data sourced from Jackson et al. (1984) .

Production Workflow

Recombinant mdoB is typically expressed in E. coli BL21(DE3) or specialized strains like Arctic Express to minimize inclusion body formation . Key steps include:

  1. Vector Design: Full-length mdoB cloned into pET or pQE vectors with His-tags .

  2. Induction: IPTG-induced expression at 16–25°C for soluble protein .

  3. Purification: Ni-NTA affinity chromatography followed by size-exclusion chromatography .

Challenges and Solutions

  • Solubility: Lowering expression temperatures (17°C) improves solubility by 30% in strains like BL21 Arctic Express .

  • Yield: Typical yields range from 0.1–1.0 mg/mL post-reconstitution .

Functional Significance in Bacterial Physiology

  • Osmoregulation: MDOs modified by mdoB help E. coli adapt to osmotic stress by balancing periplasmic solute concentrations .

  • Phospholipid Recycling: The enzyme links phospholipid metabolism (via phosphatidylglycerol) to MDO biosynthesis, reducing membrane stress .

Applications and Research Relevance

  • Biochemical Studies: Used to investigate phosphoglycerol transfer mechanisms and MDO biosynthesis .

  • Industrial Enzymology: Potential applications in synthetic biology for engineering osmo-tolerant bacterial strains .

Key Research Findings

  1. Genetic Mapping: mdoB is cotransducible with serB (56%) and thr (36%), confirming its locus near 99 min .

  2. Enzyme Redundancy: Phosphoglycerol transferase II (soluble periplasmic enzyme) does not compensate for mdoB loss, highlighting its unique role .

  3. Pathogen Relevance: E. coli O8 strains expressing mdoB have been linked to diarrheal outbreaks, though virulence mechanisms remain understudied .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. For dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For ease of use, we suggest centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form maintains stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please let us know, and we will prioritize developing the specified tag.
Synonyms
mdoB; opgB; ECIAI1_4581; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
mdoB
Target Protein Sequence
MSELLSFALFLASVLIYAWKAGRNTWWFAATLTVLGLFVVLNITLFASDYFTGDGINDAV LYTLTNSLTGAGVSKYILPGIGIVLGLTAVFGALGWILRRRRHHPHHFGYSLLALLLALG SVDASPAFRQITELVKSQSRDGDPDFAAYYKEPSKTIPDPKLNLVYIYGESLERTYFDNE AFPDLTPELGALKNEGLDFSHTQQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGSEELKSVVADPHYRND WGFYDDTVLDEAWKKFEELSRSGQRFSLFTLTVDTHHPDGFISRTCNRKKYDFDGKPNQS FSAVSCSQENIAAFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFVIRG DKPQQETLAVKRNTMDNGATVLDILGGDNYLGLGRSSLSGQSMSEIFLNIKEKTLAWKPD IIRLWKFPKEMKEFTIDQQKNMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWVDRCYKMAQLWAPELALSTDWCVSQGQLGGQQIVQHVDKTTWQGKTAFKD TVIDMARYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYKHPLPKKFDLVITAKAYGNNASRPIPVRVGNEEQTLVLGNEVTTTTLHFDNP TDADTLVIVPPEPVSTNEGNILGHSPRKLGIGMVEIKVVEREG
Uniprot No.

Target Background

Function
This protein catalyzes the transfer of a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links
Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphoglycerol transferase I (mdoB) in Escherichia coli?

Phosphoglycerol transferase I is an enzyme located in the inner cytoplasmic membrane of Escherichia coli that catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides (MDO) or to model substrates such as arbutin (p-hydroxyphenyl-β-D-glucoside). The products of this reaction are phosphoglycerol diester derivatives and sn-1,2-diglyceride . The enzyme is encoded by the mdoB gene, which maps near minute 99 on the E. coli chromosome between the serB and thr genes in the clockwise direction . This transferase plays a critical role in the biosynthesis pathway of membrane-derived oligosaccharides, contributing to membrane function and periplasmic adaptation.

What is the biosynthetic pathway involving Phosphoglycerol transferase I?

Phosphoglycerol transferase I is part of a complex biosynthetic pathway for membrane-derived oligosaccharides (MDO). According to the working model of MDO biosynthesis, the process begins with UDP-glucose carrier in the cytoplasm. Phosphoglycerol transferase I then transfers phosphoglycerol residues from phosphatidylglycerol to the carrier-bound MDO, producing diglyceride and MDO with phosphoglycerol residues . The enzyme's active site is located on the outer aspect of the inner membrane, enabling it to catalyze the transfer of phosphoglycerol residues to substrates in the periplasmic space .

Following the initial phosphoglycerol transfer, a second enzyme, phosphoglycerol transferase II (a periplasmic enzyme), can catalyze the interchange of phosphoglycerol residues among soluble species of MDO, potentially creating multiply substituted MDO in the periplasm .

How is the mdoB gene characterized in E. coli?

The mdoB gene has been characterized through both genetic and biochemical approaches:

  • Genetic mapping: Three-factor crosses via P1 transduction have established the gene order as mdoB-serB-thr in the clockwise direction .

  • Mutant isolation: mdoB mutants have been isolated based on arbutin resistance in strains carrying the dgk mutation (defective in diglyceride kinase). The selection strategy exploits the fact that when strains with the dgk mutation are grown in medium containing arbutin, they accumulate large amounts of sn-1,2-diglyceride (a product of the phosphoglycerol transferase I reaction), which inhibits growth. A further mutation leading to loss of phosphoglycerol transferase I activity results in arbutin resistance .

  • Phenotypic characterization: mdoB mutants simultaneously lose:

    • Phosphoglycerol transferase I activity in vitro

    • Ability to transfer phosphoglycerol to arbutin in vivo

    • Ability to incorporate phosphoglycerol residues into MDO

What are membrane-derived oligosaccharides (MDO) and how do they relate to mdoB?

Membrane-derived oligosaccharides (MDO) are complex, branched glucans located in the periplasmic space of Gram-negative bacteria like E. coli. They consist primarily of glucose residues with various substituents, including phosphoglycerol, phosphoethanolamine, and O-succinyl ester groups.

The relationship between MDO and mdoB is direct and functional:

  • Modification role: Phosphoglycerol transferase I (encoded by mdoB) is responsible for transferring phosphoglycerol residues from phosphatidylglycerol to MDO .

  • Structural impact: MDO isolated from mdoB mutants are completely devoid of phosphoglycerol residues, containing less than 3% of the phosphoglycerol content found in wild-type strains . This provides strong genetic evidence for the function of phosphoglycerol transferase I in MDO biosynthesis.

  • Carrier-bound interaction: Research suggests that the true physiological substrate for phosphoglycerol transferase I is not the soluble form of MDO, but rather a carrier-bound form located in the membrane .

What experimental approaches are used to study mdoB mutants in E. coli?

Several sophisticated experimental approaches have been employed to study mdoB mutants:

  • Transposon mutagenesis: Tn10 transposon has been used to create mdoB::Tn10 insertional mutants, allowing for genetic manipulation and characterization .

  • Enzymatic assays: Phosphoglycerol transferase I activity can be measured in vitro using:

    • Arbutin as a model substrate

    • MDO labeled with [2-³H]glycerol as a substrate

    • Phosphatidylglycerol as a phosphoglycerol donor

  • MDO isolation and analysis: MDOs are purified by chromatography, and their composition is analyzed by:

    • Glucose content determination using colorimetric methods

    • Phosphoglycerol content assay after treatment with HF to liberate glycerol

  • In vivo transfer assays: The ability to transfer phosphoglycerol to arbutin in vivo can be assessed by growing cells in medium containing arbutin and measuring diglyceride accumulation in dgk mutant backgrounds .

StrainPhosphoglycerol transferase I activity (nmol/h per mg of protein)mol of P-GRO per mol of MDO
AB1133 mdoB+6.02.0
NFB114 mdoB1<0.050.06
PT227 mdoB::Tn10<0.090.05

Table 1: Effect of mdoB mutations on enzyme activity and MDO composition

How does Phosphoglycerol transferase I differ from Phosphoglycerol transferase II?

The two phosphoglycerol transferases in E. coli have distinct properties and functions:

  • Cellular location:

    • Transferase I (mdoB product): Inner cytoplasmic membrane-bound enzyme

    • Transferase II: Soluble, periplasmic enzyme

  • Substrate specificity:

    • Transferase I: Utilizes phosphatidylglycerol as the phosphoglycerol donor

    • Transferase II: Does not utilize phosphatidylglycerol as a donor, but catalyzes the interchange of phosphoglycerol residues among soluble species of MDO

  • Function in MDO biosynthesis:

    • Transferase I: Primary transfer of phosphoglycerol residues from phosphatidylglycerol to MDO

    • Transferase II: Secondary redistribution of phosphoglycerol residues among soluble MDO molecules

  • Genetic independence:

    • mdoB mutants lack Transferase I activity but retain normal Transferase II activity (0.31 U/mg in wild-type vs. 0.33 U/mg in mdoB mutant)

This functional differentiation provides strong evidence that phosphoglycerol transferase II is not involved in the primary transfer of phosphoglycerol residues from phosphatidylglycerol to MDO, but rather in the subsequent modification of soluble MDO species.

What is known about E. coli O8 serotype in relation to mdoB?

E. coli O8 belongs to a specific O-antigen serotype, which is determined by the structure of lipopolysaccharide (LPS) O-antigen. While the specific relationship between mdoB and the O8 serotype has not been directly addressed in the provided search results, important connections can be made:

  • O-antigen biosynthesis: In E. coli O8, the O antigen gene cluster is located between the gnd and hisI genes, which is atypical for E. coli but normal for Klebsiella . This location differs from the mdoB gene location (near minute 99).

  • Biosynthetic pathway: The O8 O-antigen is synthesized via the ABC transporter pathway rather than the Wzx/Wzy pathway used by most E. coli O-antigens . In this pathway, a methyltransferase is involved in terminating the O polysaccharide chain.

  • Relevance to recombinant protein production: When producing recombinant proteins in E. coli O8, understanding the interplay between membrane components (including phosphoglycerol transferase I) and the specific O-antigen structure becomes important for optimizing expression systems .

What methods are available for expression and purification of recombinant phosphoglycerol transferase I?

Expression and purification of recombinant phosphoglycerol transferase I can be approached using several methods:

  • Expression systems:

    • E. coli-based expression systems using vectors such as pBR322-based plasmids

    • Inducible promoters like the phosphate-starvation-inducible phoA promoter or IPTG-inducible taclacUV5 promoter

    • Optimization of translation initiation regions with strong ribosome binding sites and optimal spacers

  • Purification strategies:

    • Affinity chromatography using His-tags (similar to strategies for other recombinant E. coli proteins)

    • Membrane protein extraction techniques using detergents

    • Size exclusion and ion exchange chromatography

  • Quality assessment:

    • Enzymatic activity assays using arbutin as substrate

    • SDS-PAGE for purity assessment

    • Western blotting for protein identification

  • Protein characterization:

    • Determination of specific activity

    • Structural analysis using crystallography techniques (similar to approaches used for related proteins)

The challenges in purifying membrane-associated proteins like phosphoglycerol transferase I often require optimization of detergent conditions and consideration of protein stability during extraction from the membrane environment.

How do experimental design approaches enhance mdoB research?

Effective experimental design is crucial for advancing mdoB research, particularly when investigating complex membrane protein functions. Key approaches include:

  • Design of Experiments (DOE) methodology:

    • Systematic planning to minimize the number of experiments while maximizing information

    • Identification of key variables affecting mdoB expression and function

    • Statistical optimization of expression conditions for recombinant protein production

  • Factorial designs:

    • Testing multiple factors simultaneously (e.g., temperature, induction time, media composition)

    • Identifying interactions between factors that affect enzyme activity

  • Response surface methodology:

    • Optimization of conditions for maximum mdoB expression or activity

    • Development of predictive models for protein yield and functionality

  • Controls and validation:

    • Appropriate positive and negative controls for enzyme assays

    • Independent validation of results using multiple methods

    • Reproducibility testing across different laboratories

A well-designed experimental approach follows this process:

How do environmental conditions affect mdoB expression and activity?

Environmental conditions significantly impact mdoB expression and phosphoglycerol transferase I activity:

  • Oxygen levels:

    • Hypoxic and hyperoxic conditions can affect recombinant protein expression in E. coli

    • Both oxygen exposure and recombinant protein production can cause adverse effects on microbial fermentation, including increased proteolytic and oxidative damage

    • Global gene expression analysis has shown that oxygen levels influence numerous cellular pathways that may indirectly affect mdoB expression

  • Growth phase effects:

    • Proteomic analyses of E. coli at different growth phases reveal significant protein changes over time

    • During high-cell-density fermentations, 81 protein spots changed significantly between early (14h) and late (72h) phases in control fermentations

    • These physiological changes include up-regulation of phosphate starvation proteins and down-regulation of ribosomal proteins and nucleotide biosynthesis proteins

  • Metabolic state:

    • Recombinant protein production leads to increased expression of heat-shock genes, including proteases and chaperones

    • Production of recombinant proteins can result in catabolite repression and decreased amino acid biosynthesis

    • These changes may affect the folding and activity of membrane proteins like phosphoglycerol transferase I

  • Stress responses:

    • The synthesis of stress protein phage shock protein A (PspA) is strongly correlated with synthesis of recombinant products

    • Understanding these stress responses is critical for optimizing expression of functional mdoB

What analytical techniques are most effective for studying phosphoglycerol transferase I activity?

Several analytical techniques have proven effective for studying phosphoglycerol transferase I activity:

  • Enzymatic assays:

    • In vitro transfer assays using radiolabeled substrates (e.g., [2-³H]glycerol-labeled compounds)

    • Colorimetric assays for detection of reaction products

    • High-performance liquid chromatography (HPLC) for separation and quantification of enzymatic products

  • Structural analysis:

    • X-ray crystallography for determining protein structure (as applied to related proteins)

    • NMR spectroscopy for analyzing protein-substrate interactions

    • Circular dichroism (CD) for assessing secondary structure elements

  • Genetic approaches:

    • Site-directed mutagenesis to identify critical residues for enzyme activity

    • Complementation assays to confirm gene function

    • Suppressor screens to identify interacting components

  • Proteomic methods:

    • Two-dimensional polyacrylamide gel electrophoresis (2D-PAGE) for protein expression profiling

    • Mass spectrometry for protein identification and post-translational modification analysis

    • Western blotting for specific protein detection

  • Membrane protein analysis:

    • Detergent-based extraction methods

    • Liposome reconstitution assays

    • Native membrane isolation techniques

The combination of these approaches provides comprehensive insights into the function, regulation, and interactions of phosphoglycerol transferase I in E. coli.

How can transcriptomic approaches enhance understanding of mdoB regulation?

Transcriptomic approaches offer powerful tools for understanding mdoB regulation:

  • DNA microarray analysis:

    • Global transcriptional profiling under different environmental conditions

    • Identification of co-regulated genes

    • For example, DNA microarrays have been used to monitor global gene expression of E. coli during exposure to defined aeration conditions, revealing effects of oxygen and recombinant protein production

  • RNA-Seq:

    • More sensitive detection of gene expression changes

    • Identification of alternative splicing or promoter usage

    • Detection of non-coding RNAs that might regulate mdoB expression

  • Quantitative PCR (qPCR):

    • Targeted validation of expression changes

    • Higher sensitivity for low-abundance transcripts

    • Time-course analysis of expression dynamics

  • Reporter gene systems:

    • Fusion of mdoB promoter with reporter genes (GFP, lacZ)

    • Real-time monitoring of gene expression

    • High-throughput screening of regulatory factors

  • Integration with other -omics approaches:

    • Correlation of transcriptomic data with proteomic changes

    • Mapping of regulatory networks affecting membrane protein expression

    • Machine learning approaches to identify subtle regulatory patterns

These approaches can reveal how mdoB expression is affected by various environmental conditions, stress responses, and metabolic states, providing insights for optimizing recombinant protein production.

What are the best approaches for studying membrane protein-lipid interactions in the context of mdoB?

Understanding how phosphoglycerol transferase I interacts with membrane lipids requires specialized approaches:

  • Membrane mimetic systems:

    • Liposomes with defined lipid composition

    • Nanodiscs for isolated membrane protein-lipid studies

    • Bicelles and micelles for NMR and crystallography studies

  • Biophysical techniques:

    • Förster resonance energy transfer (FRET) for monitoring protein-lipid proximity

    • Differential scanning calorimetry to assess protein-induced changes in membrane properties

    • Surface plasmon resonance (SPR) for binding kinetics

  • Molecular dynamics simulations:

    • Computational modeling of protein-lipid interactions

    • Prediction of binding sites and orientation in the membrane

    • Simulation of conformational changes during catalysis

  • Chemical biology approaches:

    • Photoaffinity labeling with lipid analogs

    • Click chemistry for site-specific detection of interactions

    • Mass spectrometry to identify lipid binding sites

  • Functional assays in reconstituted systems:

    • Proteoliposomes with varying lipid compositions

    • Measurement of enzyme activity as a function of membrane properties

    • Assessment of substrate accessibility in different membrane environments

These approaches can provide critical insights into how phosphoglycerol transferase I recognizes its phosphatidylglycerol substrate in the membrane and catalyzes the transfer reaction to membrane-derived oligosaccharides.

What are the major challenges in studying recombinant phosphoglycerol transferase I?

Studying recombinant phosphoglycerol transferase I presents several significant challenges:

  • Membrane protein expression issues:

    • Potential toxicity when overexpressed

    • Proper folding and insertion into membranes

    • Achieving sufficient yield for structural studies

  • Functional assessment complexities:

    • Requirement for proper membrane environment

    • Need for appropriate lipid substrates

    • Development of sensitive and specific activity assays

  • Structural characterization difficulties:

    • Challenges in crystallizing membrane proteins

    • Complexity of maintaining native conformation during purification

    • Technical difficulties in structural analysis of membrane-embedded regions

  • Physiological relevance:

    • Ensuring that recombinant protein reflects native function

    • Understanding context-dependent activity in the membrane

    • Correlating in vitro findings with in vivo function

  • Technical limitations:

    • Need for specialized equipment and expertise

    • Cost and time constraints for membrane protein research

    • Reproducibility challenges across different expression systems

Addressing these challenges requires interdisciplinary approaches combining molecular biology, biochemistry, biophysics, and computational methods.

What are promising directions for future research on phosphoglycerol transferase I?

Future research on phosphoglycerol transferase I could explore several promising directions:

  • Structure-function relationships:

    • High-resolution structural studies using cryo-electron microscopy or X-ray crystallography

    • Identification of catalytic residues and substrate binding sites

    • Engineering of enhanced variants with improved catalytic properties

  • Systems biology approaches:

    • Integration of transcriptomic, proteomic, and metabolomic data

    • Network analysis of interactions with other cellular components

    • Modeling of MDO biosynthesis pathways and regulation

  • Synthetic biology applications:

    • Engineering of E. coli strains with modified membrane properties

    • Development of biosensors based on phosphoglycerol transferase activity

    • Creation of optimized expression systems for membrane protein production

  • Comparative studies across species:

    • Examination of phosphoglycerol transferase homologs in different bacteria

    • Evolutionary analysis of enzyme function and specificity

    • Identification of conserved mechanisms and unique adaptations

  • Therapeutic relevance:

    • Exploration as a potential antimicrobial target

    • Development of specific inhibitors

    • Investigation of role in bacterial pathogenesis and host interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.