Recombinant Escherichia coli O8 Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; ECIAI1_0672; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
kdpC
Target Protein Sequence
MRGLRPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIREGDTVRGSALIGQNFT GNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKLIAARVAALRAANPDASASIPVEL VTASASGLDNNITPQAAAWQIPRIAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVK LNLALDKLDE
Uniprot No.

Target Background

Function
This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.
Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the basic structure of the KdpC subunit in E. coli?

The KdpC subunit is part of the KdpFABC complex, a high-affinity ATP-driven K+ transport system in Escherichia coli. Structural analysis of KdpC's soluble portion (KdpCsol, residues Asn39-Glu190) reveals an alpha-helical content of approximately 44% together with an 8% beta-sheet conformation, consistent with values predicted from primary sequence analysis . The protein contains a structured nucleotide binding site located within the Val144-Lys161 peptide in the C-terminal region . KdpC features an N-terminal transmembrane segment and a soluble cytoplasmic domain that interacts with other components of the complex, particularly the catalytic KdpB subunit .

What is the primary function of KdpC in the KdpFABC complex?

KdpC functions as a catalytic chaperone in the nucleotide-binding mechanism of the KdpFABC complex. While KdpB is the primary ATP-hydrolyzing subunit of this P-type ATPase, KdpC plays an essential role in modulating the complex's activity . KdpC interacts with the nucleotide-binding loop of KdpB in an ATP-dependent manner around the ATP-binding pocket, thereby increasing ATP-binding affinity through the formation of a transient KdpB/KdpC/ATP ternary complex . This cooperative interaction is critical for efficient potassium uptake, particularly under conditions of potassium limitation .

How does the KdpFABC complex integrate with broader cellular processes in E. coli?

The KdpFABC complex represents an inducible high-affinity potassium uptake system that is expressed when E. coli experiences potassium limitation . The genes coding for the four subunits are organized in the kdpFABC operon, which is adjacent to and overlapping with the kdpDE operon coding for the regulatory proteins, the sensor kinase KdpD and the response regulator KdpE . This genetic arrangement enables coordinated expression in response to environmental stimuli. The complex functions as a unique chimera of ion pumps and ion channels, with KdpB resembling a P-type ATPase and KdpA resembling a potassium channel . This hybrid nature allows the bacterium to maintain potassium homeostasis across diverse environmental conditions, supporting critical cellular processes including osmoregulation, pH balance, and enzyme function.

How does the nucleotide-binding mechanism of KdpC differ from conventional P-type ATPases?

The nucleotide-binding mechanism in the KdpFABC complex represents a unique blend of features not found in conventional P-type ATPases or ion channels . While KdpB resembles the catalytic P-type ATPase subunit, ATP binding also occurs in the essential but noncatalytic KdpC subunit . This mechanism involves KdpC acting as a catalytic chaperone, with parallels to ABC transporters rather than typical P-type ATPases . In ABC transporters, ATP nucleotide is coordinated by the LSGGQ signature motif via double hydrogen bonds at a conserved glutamine residue, which is also present in KdpC . High-affinity nucleotide binding to the KdpFABC complex depends on this conserved glutamine residue in KdpC, demonstrating a specialized adaptation of the ATP-binding mechanism . Additionally, both ATP binding to KdpC and ATP hydrolysis activity of the complex show sensitivity to the accessibility, presence, or absence of hydroxyl groups at the ribose moiety of the nucleotide .

What experimental evidence demonstrates the importance of KdpC's ATP binding capabilities?

Several experimental approaches have provided strong evidence for KdpC's ATP binding role:

  • Labeling experiments using the photoreactive ATP analogue 8-azido-ATP resulted in the specific incorporation of one molecule of 8-azido-ATP per KdpCsol peptide, indicating a defined binding site .

  • This labeling was inhibited by preincubation with ATP, ADP, AMP, GTP, or CTP, demonstrating a structured but relatively low-specificity nucleotide binding site .

  • No labeling occurred upon denaturation of the protein with sodium dodecyl sulfate, confirming that the binding required the protein's native conformation .

  • Mass spectrometry following 8-azido-ATP labeling and tryptic digestion identified the Val144-Lys161 peptide as the ATP binding region .

  • Mutations affecting the conserved glutamine residue in KdpC significantly reduced high-affinity nucleotide binding to the KdpFABC complex .

These findings collectively establish that KdpC contains a structured nucleotide binding site essential for the complex's function.

What is known about the interaction between KdpC and the catalytic KdpB subunit?

The KdpC subunit has been shown to interact with the nucleotide-binding loop of KdpB in an ATP-dependent manner around the ATP-binding pocket . This interaction increases ATP-binding affinity through the formation of a transient KdpB/KdpC/ATP ternary complex . The cooperative model suggests that the soluble part of KdpC activates catalysis of KdpB, functioning as a regulatory element that enhances the efficiency of ATP hydrolysis and subsequent potassium transport . This interaction represents a specialized adaptation that optimizes the energy coupling in this unique transport system, which combines features of both ion pumps and channels .

What are the recommended approaches for expressing and purifying recombinant KdpC for structural studies?

For structural and functional studies of KdpC, researchers have successfully implemented the following approach:

  • Construction of expression vector: Generate a construct for the soluble portion of KdpC (KdpCsol, residues Asn39-Glu190) with appropriate affinity tags .

  • Expression system: Use E. coli expression systems with inducible promoters for controlled protein production .

  • Purification protocol: Implement a multi-step purification process:

    • Initial purification via affinity chromatography (typically using His-tag)

    • Further purification through size exclusion chromatography to achieve homogeneity

    • Verification of protein integrity via N-terminal sequencing and mass spectrometry

  • Quality assessment: Analyze the purified protein using circular dichroism spectroscopy to confirm proper secondary structure (approximately 44% alpha-helical content and 8% beta-sheet conformation) .

This approach yields pure, properly folded KdpCsol suitable for structural and functional analyses, including nucleotide binding studies and interaction assays with other components of the KdpFABC complex.

What methods are most effective for studying ATP binding to KdpC?

The following methods have proven effective for investigating ATP binding to KdpC:

  • Photolabeling with nucleotide analogues: Using photoreactive ATP analogues like 8-azido-ATP allows specific labeling of the ATP binding site. The protocol involves:

    • Incubation of purified KdpC with the analogue

    • UV irradiation to activate crosslinking

    • Detection of bound nucleotide through radioisotope labeling or specialized detection methods

  • Competition assays: Pre-incubating KdpC with various nucleotides (ATP, ADP, AMP, GTP, CTP) before adding the photoreactive analogue can reveal binding specificity and relative affinities .

  • Mass spectrometry analysis: Following labeling and proteolytic digestion, mass spectrometry can identify specific peptide regions involved in nucleotide binding .

  • Mutagenesis studies: Targeted mutations, particularly of the conserved glutamine residue implicated in nucleotide coordination, combined with binding assays, can confirm the functional importance of specific residues .

  • Structural analyses: Techniques such as X-ray crystallography or cryo-EM of KdpC with bound nucleotides provide detailed insights into binding mechanisms.

These complementary approaches provide comprehensive information about the nucleotide binding properties of KdpC and its role in the KdpFABC complex.

What experimental design considerations are important when creating KdpC deletion mutants?

When designing experiments with KdpC deletion mutants, researchers should consider:

  • Complete vs. partial deletions: Complete deletion of kdpC has been used to create deletion strains for complementation studies . Alternatively, truncation mutants retaining specific functional domains can provide insights into domain-specific roles.

  • Complementation testing: Complementation experiments using different kdpC constructs can reveal which regions are essential for function. Research has shown that a derivative lacking base pairs coding for only the four C-terminal amino acids was still able to complement a chromosomal deletion of kdpC .

  • Cross-species substitutions: Complementation experiments with kdpC from different bacterial species (e.g., successful with M. tuberculosis kdpC but not with C. acetobutylicum or Synechocystis sp. PCC6803 kdpC) can provide evolutionary insights .

  • Hybrid constructions: Creating hybrids between kdpC of different species (e.g., E. coli and C. acetobutylicum) can identify which regions can be exchanged while maintaining function. Research has shown that the N-terminal transmembrane segment and the C-terminal-third can be exchanged individually but not simultaneously .

  • Phenotypic testing: Evaluating growth in potassium-limited conditions and potassium uptake kinetics provides functional readouts for the various mutants.

  • Protein-protein interaction analysis: Assessing how deletions affect interactions with other components of the complex, particularly KdpB.

These considerations ensure that experimental designs with KdpC mutants yield meaningful insights into structure-function relationships.

How does KdpC vary across bacterial species, and what does this reveal about its evolution?

Comparative analysis of KdpC across bacterial species reveals important insights about its evolution and functional conservation:

  • Sequence conservation: Alignment of 17 different KdpC proteins from diverse bacteria shows varying degrees of conservation across species . The central regions typically show higher conservation than the terminal regions.

  • Functional complementation: Studies have demonstrated that kdpC from Mycobacterium tuberculosis can functionally complement a kdpC deletion in E. coli, while kdpC from Clostridium acetobutylicum or Synechocystis sp. PCC6803 cannot . This suggests functional conservation between some but not all bacterial KdpC proteins.

  • Domain exchangeability: Hybrid construction experiments between E. coli and C. acetobutylicum kdpC revealed that the N-terminal transmembrane segment and the C-terminal-third of the protein can be exchanged individually between these species while maintaining function, but simultaneous substitution of both regions was not possible . This indicates that specific interactions between these regions are critical for proper folding and function.

  • Co-evolution with other Kdp components: The evolutionary patterns of KdpC likely reflect co-evolution with other components of the KdpFABC complex, particularly KdpB with which it directly interacts.

What structural and functional similarities exist between KdpC and components of ABC transporters?

Despite KdpC being part of a P-type ATPase system, it shares several notable similarities with components of ABC transporters:

  • Nucleotide coordination mechanism: The ATP nucleotide in KdpC is coordinated via a mechanism similar to that in ABC transporters, specifically through the involvement of a conserved glutamine residue that forms double hydrogen bonds with the nucleotide . This differs from the typical nucleotide binding mechanisms in P-type ATPases.

  • Regulatory function: Like regulatory subunits in ABC transporters, KdpC modulates the activity of the catalytic subunit (KdpB) through direct interactions and cooperative binding of ATP .

  • Formation of a nucleotide-binding complex: KdpC participates in the formation of a transient ternary complex (KdpB/KdpC/ATP) around the ATP-binding pocket , reminiscent of the nucleotide-binding domains in ABC transporters that work in pairs to bind and hydrolyze ATP.

  • Binding site flexibility: Both KdpC and ABC transporters exhibit some flexibility in nucleotide binding, accommodating various nucleotides with different affinities .

These similarities suggest evolutionary convergence in nucleotide-binding mechanisms between these otherwise distinct transport systems, potentially reflecting common solutions to the challenges of coupling ATP hydrolysis to transport processes.

How does the function of KdpC compare to other subunits in the KdpFABC complex?

Within the KdpFABC complex, each subunit serves a distinct function, creating an integrated system for high-affinity potassium transport:

SubunitPrimary FunctionStructural CharacteristicsEvolutionary Origins
KdpAK+ translocationResembles potassium channelChannel-like protein
KdpBATP hydrolysisCatalytic core of P-type ATPaseP-type ATPase family
KdpCCatalytic chaperoneContains nucleotide binding siteUnique regulatory subunit
KdpFStabilizationSmall membrane peptideStabilizing component

While KdpB functions as the primary catalytic subunit responsible for ATP hydrolysis, KdpC serves as a regulatory partner that enhances ATP binding affinity and modulates catalytic activity . This creates a cooperative system where KdpC effectively acts as a catalytic chaperone for KdpB . In contrast, KdpA is primarily involved in potassium recognition and translocation, resembling a potassium channel rather than a pump component . KdpF, the smallest subunit, appears to play a structural role in stabilizing the complex .

This arrangement creates a unique chimeric transport system that combines features of both ion pumps (through KdpB) and ion channels (through KdpA), with KdpC providing specialized regulatory functions that optimize the energy coupling between ATP hydrolysis and potassium transport .

How can recombinant KdpC be used to develop novel antimicrobial strategies?

The essential role of the KdpFABC complex in bacterial potassium homeostasis, particularly under stress conditions, presents opportunities for antimicrobial development:

  • Targeted inhibition: The unique nucleotide-binding mechanism of KdpC, distinct from human P-type ATPases, offers a potential target for selective inhibition. Compounds that interfere with the KdpB/KdpC/ATP ternary complex formation could disrupt bacterial potassium uptake without affecting human transporters .

  • Species-selective approaches: The variations in KdpC structure across bacterial species, as demonstrated by complementation studies, suggest the possibility of developing species-specific inhibitors . This could be particularly valuable for targeting pathogenic bacteria while sparing beneficial microbiota.

  • Stress amplification: Since the KdpFABC complex is particularly important under potassium-limited conditions, compounds targeting KdpC might be especially effective in combination with treatments that induce potassium stress, creating a synergistic antimicrobial effect.

  • Structure-based drug design: The identification of specific nucleotide-binding regions within KdpC, such as the Val144-Lys161 peptide , provides structural information that could guide rational design of inhibitors that compete for this binding site.

  • Vaccine development considerations: For recombinant DNA approaches involving bacterial systems, researchers should be aware of the regulatory requirements outlined in the NIH Guidelines for Research Involving Recombinant DNA Molecules, especially for clinical applications .

These approaches would require careful consideration of recombinant DNA research guidelines, particularly for clinical applications, as outlined in the NIH Guidelines .

What are the current technical challenges in studying KdpC-mediated ATP binding and its effect on potassium transport?

Researchers face several technical challenges when investigating KdpC function:

  • Maintaining protein stability: The membrane association of the full KdpFABC complex creates challenges for structural studies, requiring careful optimization of detergent conditions or the use of truncated constructs like KdpCsol .

  • Measuring real-time interactions: Capturing the transient KdpB/KdpC/ATP ternary complex formation requires specialized techniques such as FRET, cross-linking studies, or advanced spectroscopic methods.

  • Correlating binding to transport: Establishing direct causal relationships between nucleotide binding to KdpC and potassium transport rates requires sophisticated electrophysiological techniques or transport assays with real-time monitoring capabilities.

  • Isolating KdpC effects: Distinguishing the specific contributions of KdpC from those of other subunits, particularly KdpB which also binds ATP, requires careful experimental design and mutational analyses.

  • Reconstitution systems: Creating functional reconstituted systems that preserve the native interactions between all four Kdp subunits presents technical difficulties, particularly in maintaining proper membrane orientation and stoichiometry.

  • System complexity: The chimeric nature of the KdpFABC complex, combining features of both P-type ATPases and ion channels, adds complexity to functional studies and interpretation of results .

Addressing these challenges requires interdisciplinary approaches combining structural biology, biochemistry, electrophysiology, and computational modeling.

What recent methodological advances are driving new discoveries about KdpC function?

Recent methodological advances have accelerated our understanding of KdpC function:

  • Cryo-electron microscopy: The revolution in cryo-EM technology now enables high-resolution structural determination of membrane protein complexes like KdpFABC without crystallization, providing unprecedented insights into the structural basis of KdpC's interactions with other subunits.

  • Advanced computational modeling: Techniques like molecular dynamics simulations and quantum mechanics/molecular mechanics (QM/MM) calculations allow detailed exploration of the nucleotide binding process and conformational changes in KdpC.

  • Knowledge distillation approaches: Novel computational approaches like Adaptive and Cooperative Attention Masking for Knowledge Distillation (ACAM-KD) are enhancing model prediction capabilities, which could be applied to predicting KdpC interactions and functional properties .

  • Single-molecule techniques: Methods such as single-molecule FRET and force spectroscopy enable direct observation of KdpC conformational changes and interactions with other subunits in real time.

  • High-throughput mutagenesis: Systematic mutagenesis approaches combined with functional assays allow comprehensive mapping of structure-function relationships in KdpC.

  • Native mass spectrometry: This technique preserves protein-protein and protein-ligand interactions, enabling direct visualization of the KdpB/KdpC/ATP ternary complex formation under near-native conditions.

These methodological advances are providing deeper insights into the molecular mechanisms underlying KdpC's role in the KdpFABC complex and opening new avenues for targeted interventions.

What regulatory requirements apply to research involving recombinant KdpC in academic settings?

Research involving recombinant KdpC must adhere to established regulatory frameworks:

  • NIH Guidelines compliance: Research supported by NIH funding that involves recombinant DNA is subject to the NIH Guidelines for Research Involving Recombinant DNA Molecules, which outline biosafety provisions and oversight by an Institutional Biosafety Committee (IBC) .

  • IBC review and approval: Institutions conducting research with recombinant KdpC must establish an IBC to review and approve protocols before work begins, regardless of whether the research involves human applications .

  • Documentation and reporting: Researchers must maintain appropriate documentation and submit reports as required by institutional and national guidelines .

  • Biosafety considerations: Work with recombinant E. coli strains expressing KdpC must adhere to appropriate biosafety levels and practices as determined by risk assessment and IBC review.

  • Human applications: If research progresses toward human applications (e.g., vaccine development or therapeutic approaches), additional requirements apply, including potential review by the NIH Recombinant DNA Advisory Committee (RAC), though certain vaccine trials may be exempted under specific conditions .

These requirements ensure that research with recombinant KdpC is conducted safely and responsibly, with appropriate oversight and risk management.

What expression systems are most effective for producing functional recombinant KdpC for research purposes?

For optimal production of functional recombinant KdpC, researchers should consider the following expression systems and strategies:

  • E. coli expression systems: Homologous expression in E. coli has proven effective for producing both the soluble portion (KdpCsol) and full-length KdpC . Benefits include:

    • Natural processing and folding environment

    • Compatibility with native interaction partners

    • Established protocols for induction and purification

  • Fusion tags and purification strategies:

    • Affinity tags (His, GST, MBP) facilitate purification while potentially enhancing solubility

    • For the soluble domain (KdpCsol), direct expression as a soluble protein is effective

    • For full-length KdpC, membrane protein expression techniques may be required

  • Co-expression considerations:

    • For functional studies, co-expression with other Kdp subunits may improve stability and activity

    • The complete KdpFABC complex remains intact upon solubilization and purification in the presence of nonionic detergents

  • Expression conditions optimization:

    • Temperature, inducer concentration, and induction timing significantly impact yield and functionality

    • Lower temperatures (16-25°C) often improve proper folding of membrane-associated proteins

  • Verification methods:

    • Protein integrity confirmation via N-terminal sequencing, mass spectrometry, and circular dichroism spectroscopy

    • Functional verification through ATP binding assays

These approaches should be tailored to the specific experimental goals, whether structural studies, binding assays, or functional reconstitution of the transport complex.

How can researchers optimize experimental designs for functional studies of mutant KdpC proteins?

For effective functional studies of KdpC mutants, researchers should implement the following experimental design considerations:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.