Recombinant Escherichia coli O8 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Key Features of Recombinant ArnE

PropertyDetails
Source OrganismEscherichia coli O8 (originally characterized in Salmonella typhimurium and Yersinia pseudotuberculosis)
Expression SystemE. coli (in vitro recombinant expression with N-terminal His tag)
Protein Length114 amino acids (full-length)
SequenceMNSYLLLLMVSLLTCIGQLCQKQAAQCWEQPQARRLNLTLRWLAIAVVSLGLGMLLWLRL...
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Functional Role in Lipid A Modification

ArnE is essential for the L-Ara4N-mediated modification of lipid A, a process critical for bacterial resistance to polymyxin antibiotics . The enzymatic pathway involves:

  1. Biosynthesis: L-Ara4N is synthesized via the arnABCD gene products.

  2. Membrane Translocation: ArnE/ArnF flips undecaprenyl phosphate-α-L-Ara4N across the inner membrane .

  3. Transfer to Lipid A: The periplasmic ArnT glycosyltransferase attaches L-Ara4N to lipid A, neutralizing its negative charge .

Genetic Operon Structure

GeneRenamed DesignationFunction
pmrHarnBUDP-glucose 4-epimerase
pmrIarnCUndecaprenyl phosphate-L-Ara4N transferase
pmrJarnDL-Ara4N formylation enzyme
pmrLarnEFlippase subunit
pmrMarnFFlippase subunit

Chromosomal inactivation of arnE or arnF abolishes L-Ara4N transfer to lipid A, confirming their role in substrate transport .

Research Findings

  1. Inactivation Studies:

    • Deletion of arnE in E. coli eliminates polymyxin resistance by disrupting L-Ara4N translocation .

    • Complementation with recombinant ArnE restores flippase activity .

  2. In Vitro Assays:

    • Synthetic undecaprenyl phosphate-α-L-Ara4N analogs with Z-configured terpene units (e.g., α-neryl derivatives) serve as substrates for ArnT, confirming ArnE’s role in flipping native substrates .

  3. Structural Modeling:

    • Homology models predict ArnE’s resemblance to P4B ATPases like Neo1, with conserved ATPase domains and lipid-binding pockets .

Applications and Implications

  • Antibiotic Resistance: ArnE is a potential target for inhibitors to restore polymyxin efficacy against multidrug-resistant E. coli .

  • Biochemical Tools: Recombinant ArnE enables in vitro studies of LPS modification pathways .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnE; ECIAI1_2335; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
arnE
Target Protein Sequence
MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQN VPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV
Uniprot No.

Target Background

Function

Function: Translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane from the cytoplasm to the periplasm.

Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of ArnE in bacterial cell membranes?

ArnE functions as a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase, which translocates modified arabinose from the cytoplasmic to the periplasmic side of the inner membrane. According to structural analyses, ArnE forms a heterodimer with ArnF to create a complete flippase complex . The modified arabinose is ultimately attached to lipid A in the bacterial outer membrane, which is required for resistance to polymyxin and cationic antimicrobial peptides . ArnE contains an EamA domain and is classified as a member of the ArnE family of membrane proteins with multiple transmembrane segments .

How does the ArnE-mediated lipid A modification contribute to antimicrobial resistance?

The addition of 4-amino-4-deoxy-L-arabinose to lipid A reduces the negative charge of the bacterial outer membrane, decreasing the electrostatic attraction between cationic antimicrobial peptides and the cell surface. This modification creates a more positively charged outer membrane that repels cationic antimicrobial compounds, including polymyxins which are often used as last-resort antibiotics. Research has shown that strains with functional arnE genes demonstrate significantly higher minimum inhibitory concentrations (MICs) against polymyxin B and other cationic antimicrobial peptides compared to knockout strains .

Which E. coli strains are most effective for expressing recombinant ArnE protein?

A systematic comparison of E. coli expression strains revealed that Arctic Express (DE3) often yields better recovery of membrane proteins like ArnE . This strain combines low temperature-adapted chaperones Cpn10 and Cpn60, similar to E. coli GroEL and GroES, resulting in chaperone-assisted protein expression at lower temperatures (11°C) . Other strains that may be suitable include:

StrainSpecial featuresOptimal induction temperatureIPTG concentration
Arctic Express (DE3)Cold-adapted chaperones11°C1 mM
pT-GroECo-expresses molecular chaperones18°C1 mM
Lemo21(DE3)Tunable expression30°C0.4 mM
Rosetta-Gami 2 (DE3)Enhanced disulfide bond formation18°C1 mM

The strain selection should be based on a scalable screening approach, particularly for difficult-to-express membrane proteins like ArnE .

What expression vector systems optimize recombinant ArnE production?

For membrane proteins like ArnE, vectors with strong but controllable promoters have shown success. The pQE32 expression system with a T5 promoter under the control of the lac operator has been effective for similar membrane proteins . This system is particularly advantageous when using lactose-containing substrates as carbon sources, as it avoids the need for inducer addition .

For improved solubility, fusion protein approaches using the pET-Trx1A/LIC vector system have demonstrated effectiveness. This system incorporates an N-terminal His-tag fused to thioredoxin with a TEV protease cleavage site, significantly enhancing the solubility of membrane-associated proteins .

How can researchers optimize ArnE expression in laboratory settings?

Optimizing ArnE expression requires careful consideration of several parameters:

  • Temperature regulation: Lower temperatures (11-18°C) slow protein synthesis, allowing more time for proper folding of membrane proteins. Arctic Express strains should be induced at 11°C, while other strains perform better at 18°C for membrane proteins .

  • Induction parameters: For ArnE expression, IPTG concentrations should be optimized between 0.4-1.0 mM depending on the strain. Lemo21(DE3) performs optimally with 0.4 mM IPTG, while other strains typically require 1.0 mM .

  • Media selection: Auto-induction media like ZYP5052 has shown superior results for membrane protein expression compared to standard LB medium with IPTG induction .

  • N-terminal sequence optimization: The nucleotides immediately following the start codon significantly influence protein expression. FACS-based screening of N-terminal coding DNA libraries can identify optimal sequences that increase expression yields up to 30-fold .

  • Co-expression of molecular chaperones: Strains like pT-GroE that co-express chaperones help with proper protein folding, especially for complex membrane proteins .

What purification methods are most effective for recombinant ArnE protein?

Due to ArnE's hydrophobic nature as a membrane protein, specialized purification approaches are necessary:

  • Membrane fraction isolation: After cell lysis, differential centrifugation should be used to separate the membrane fraction containing ArnE.

  • Detergent solubilization: Screening multiple detergents (DDM, LDAO, or C12E8) is crucial for optimal solubilization of ArnE from membranes.

  • Affinity chromatography: When expressed with His-tags, IMAC purification using Ni-NTA resin with detergent-containing buffers is effective. Based on SDS-PAGE analysis, protein purity can be quantified using software like ImageJ, with band intensities normalized to molecular weight markers for accurate comparison across gels .

  • Size exclusion chromatography: This step helps separate properly folded ArnE-ArnF complexes from aggregates and improves sample homogeneity.

What methods can elucidate ArnE-ArnF complex formation and activity?

Several advanced techniques can be employed to study ArnE-ArnF interactions:

  • Co-purification assays: When co-expressing ArnE and ArnF with different affinity tags, sequential purification can confirm complex formation.

  • Native gel electrophoresis: Blue native PAGE can preserve protein-protein interactions, allowing visualization of intact ArnE-ArnF complexes.

  • Liposome reconstitution assays: Purified ArnE-ArnF complexes can be reconstituted into liposomes with fluorescently labeled 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol analogs to directly measure flippase activity by tracking fluorescence changes.

  • Surface plasmon resonance: This technique enables real-time analysis of ArnE-ArnF binding kinetics and can assess how mutations affect complex formation.

  • Structural analysis: Cryo-electron microscopy has emerged as the preferred method for membrane protein complexes like ArnE-ArnF, providing insights into the structural basis of flippase activity.

How can genetic engineering techniques be used to study ArnE function?

Advanced genetic approaches offer powerful tools for ArnE functional analysis:

  • Recombineering with λ-Red system: This method enables precise chromosomal engineering in E. coli using electroporated linear DNA. A defective λ prophage supplies functions that protect and recombine the DNA, allowing for site-specific mutations without traditional cloning .

  • Cysteine scanning mutagenesis: Systematic replacement of amino acids with cysteine residues followed by accessibility studies can map the membrane topology of ArnE.

  • Domain swapping: Creating chimeric proteins between ArnE from different bacterial species can identify functional domains and species-specific differences in activity.

  • Reporter fusions: Fusing ArnE to reporters like GFP can track subcellular localization and expression levels. As demonstrated with other proteins, fluorescent proteins can be used with FACS to select high-expressing variants .

How is the arnE gene organized within bacterial genomes?

The arnE gene is part of the bacterial lipopolysaccharide modification pathway. In E. coli and related species, genomic analyses reveal:

  • The arnE gene is typically found within the wb* gene cluster (previously referred to as rfb), which directs O-antigen polysaccharide synthesis .

  • In some E. coli strains, there is a characteristic wc-gnd-wb*-his gene organization pattern where the wb* region contains arnE .

  • Comparative genomics indicates that while manCB sequences in O-antigen synthesis regions show considerable variation (up to 8% difference), the arnE-containing regions show greater conservation within serotype groups .

  • Different E. coli serotypes (O8, O9, O9a) show varying levels of sequence conservation in the regions containing arnE, reflecting their evolutionary relationships .

How have recombination events shaped arnE gene evolution across bacterial species?

Recombinant transfer has played a crucial role in arnE evolution:

  • Analysis of E. coli genomes reveals that the entire basic genome, including functional genes like arnE, is continually exchanged by homologous recombination with genome fragments acquired from other bacteria .

  • Evolutionary groups of E. coli exchange DNA preferentially within the same group but also with other groups to different extents, creating mosaic patterns of gene ancestry .

  • Evidence suggests that E. coli serotype O9a might have been generated by the insertion of the Klebsiella O3 wb* gene (which includes arnE) into a certain E. coli strain, demonstrating horizontal gene transfer between genera .

  • Entering DNA is often fragmented by restriction systems of the recipient cell, with surviving pieces replacing homologous parts of the recipient chromosome, contributing to the mosaic structure of arnE genes .

Why might recombinant ArnE express poorly, and how can this be addressed?

Several factors can contribute to poor ArnE expression:

  • N-terminal sequence issues: The nucleotides immediately following the start codon significantly influence translation efficiency. A directed evolution approach using FACS to select for high-expressing variants can identify optimal sequences, increasing yields up to 30-fold .

  • Codon usage bias: E. coli strains like Rosetta that supply rare tRNAs can improve expression of genes with non-optimal codons.

  • Protein toxicity: Membrane protein overexpression can disrupt membrane integrity. Using tightly regulated expression systems and lower growth temperatures can mitigate toxicity issues.

  • Improper folding: Co-expression of molecular chaperones using strains like pT-GroE can improve proper folding of membrane proteins .

  • Degradation: Protease-deficient strains may be beneficial for proteins prone to degradation during expression.

What strategies can overcome solubility issues with recombinant ArnE?

As a membrane protein, ArnE presents inherent solubility challenges that can be addressed through:

  • Fusion partners: Thioredoxin (TrxA) and glutathione S-transferase (GST) fusions have been shown to enhance solubility of membrane-associated proteins .

  • Expression temperature: Lower temperatures (11-18°C) slow protein synthesis, allowing more time for proper folding and reducing inclusion body formation .

  • Detergent screening: Systematic testing of different detergents for membrane extraction can identify optimal conditions for maintaining ArnE in solution.

  • Truncation constructs: Designing constructs that remove highly hydrophobic regions while maintaining functional domains can improve solubility.

  • Bicistronic expression: For proteins requiring partners like ArnE-ArnF, co-expression using bicistronic constructs can improve complex formation and stability .

How might structural studies of ArnE advance antimicrobial resistance research?

Structural elucidation of ArnE would provide valuable insights for antimicrobial development:

  • Drug target identification: Detailed structural information could reveal potential binding sites for small molecules that could inhibit ArnE function, thereby restoring sensitivity to polymyxins.

  • Resistance mechanism clarification: Understanding the structural basis of how ArnE facilitates LPS modification would illuminate a key resistance mechanism.

  • Structure-guided mutagenesis: With structural data, targeted mutations could identify critical residues for flippase function and substrate specificity.

  • Comparative structural biology: Comparing ArnE structures across different bacterial species could reveal conserved features that represent broad-spectrum targets for inhibition.

What novel applications might emerge from engineered ArnE variants?

Engineered ArnE proteins could have several biotechnological applications:

  • Biosensor development: Engineered ArnE variants could potentially be used to detect specific lipid molecules or antimicrobial compounds.

  • Synthetic biology tools: Modified ArnE could be repurposed to flip other molecules across membranes in engineered biological systems.

  • Vaccine development: Understanding ArnE's role in modifying bacterial surfaces could inform the development of attenuated vaccine strains with modified LPS.

  • Diagnostic markers: ArnE expression levels might serve as indicators of antimicrobial resistance potential in clinical isolates.

  • Drug delivery systems: Knowledge of ArnE's flipping mechanism could inspire biomimetic approaches for delivering therapeutic molecules across biological barriers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.