Recombinant Escherichia coli O8 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O8 ArnF

The protein "Recombinant Escherichia coli O8 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (ArnF)" is a component of the Arn pathway in E. coli O8, which is involved in resistance to the antibiotic polymyxin B . ArnF is a flippase subunit, which means it is responsible for flipping or translocating a molecule across a membrane. In this case, it moves 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol, a modified sugar, across the bacterial inner membrane . This modification is then added to lipid A, a component of the lipopolysaccharide (LPS) layer, which leads to polymyxin resistance.

Role of ArnF in Polymyxin Resistance

Polymyxins target the LPS layer of Gram-negative bacteria . Modification of lipid A with 4-amino-4-deoxy-L-arabinose (L-Ara4N) reduces the negative charge of the bacterial surface, decreasing the affinity of polymyxins for the bacterial membrane and thus conferring resistance . ArnF plays a crucial role in this process by ensuring the availability of the modified sugar on the periplasmic side of the inner membrane, where it can be attached to lipid A.

Protein Structure and Function

While the precise structure of ArnF has not been fully elucidated, it is presumed to have structural features common to flippases and membrane proteins. Flippases typically have multiple transmembrane domains that form a channel or pathway for the substrate to pass through the membrane.

Functional Aspects

  • Substrate Specificity: ArnF specifically recognizes and binds to 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol .

  • Flipping Mechanism: The exact mechanism is not known, but it likely involves conformational changes that expose the substrate to either side of the membrane.

  • Interaction with Other Proteins: ArnF likely interacts with other proteins in the Arn pathway to ensure efficient modification of lipid A.

Sequence Analysis and Homology

ArnF belongs to a family of proteins involved in lipid modification and transport. Sequence analysis reveals conserved motifs and domains that are important for its function.

Conserved Sequence Motifs

  • ATP-binding motifs: Some flippases utilize ATP to drive the translocation of substrates across the membrane. While it is not yet confirmed whether ArnF uses ATP, the presence of these motifs suggests a potential energy-dependent mechanism.

  • Membrane-spanning domains: Analysis of the ArnF sequence predicts multiple alpha-helical transmembrane domains, consistent with its function as a flippase 7.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, and may serve as a reference for customers.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnF; ECIAI1_2336; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
arnF
Target Protein Sequence
MGLMWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIF LPMTKQRY
Uniprot No.

Target Background

Function
This protein translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane of *Escherichia coli*, from the cytoplasm to the periplasm.
Database Links
Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ArnF and what is its primary function in E. coli?

ArnF (previously designated as PmrL) is a membrane protein subunit that functions as part of an undecaprenyl phosphate-alpha-L-Ara4N flippase complex in Escherichia coli. This protein plays a critical role in transporting the undecaprenyl phosphate-alpha-L-Ara4N molecule across the inner membrane, which is essential for the modification of lipid A with 4-amino-4-deoxy-L-arabinose (L-Ara4N) . This modification process is fundamental to bacterial resistance against polymyxin and various cationic antimicrobial peptides, making ArnF an important target for antimicrobial resistance research . The protein works in conjunction with ArnE (previously PmrM) as components of a membrane transport system that ensures the L-Ara4N moiety reaches the periplasmic side of the inner membrane where it can be transferred to lipid A by ArnT .

How is ArnF involved in bacterial antimicrobial resistance mechanisms?

ArnF contributes to antimicrobial resistance through its essential role in lipid A modification. Chromosomal inactivation studies of arnF in E. coli have demonstrated that without functional ArnF, bacteria switch from a polymyxin-resistant phenotype to a polymyxin-sensitive phenotype . The mechanism involves the translocation of undecaprenyl phosphate-alpha-L-Ara4N across the inner membrane. When arnF is inactivated, although the lipid-linked donor molecules are still synthesized at normal levels, they fail to be properly concentrated on the periplasmic surface of the inner membrane . This disruption was experimentally confirmed through reduced labeling with inner membrane-impermeable amine reagent N-hydroxysulfosuccinimidobitin in arnF mutants compared to wild-type strains . The L-Ara4N modification of lipid A creates a positive charge on the bacterial outer membrane, reducing the binding affinity of cationic antimicrobial peptides, thereby conferring resistance .

What experimental approaches are used to verify ArnF function?

Researchers employ several experimental approaches to verify ArnF function:

  • Gene knockout studies: Chromosomal inactivation of arnF in polymyxin-resistant E. coli strains, followed by assessment of phenotypic changes in antibiotic sensitivity .

  • Membrane localization assays: Using membrane-impermeable reagents like N-hydroxysulfosuccinimidobitin to quantify the presence of undecaprenyl phosphate-alpha-L-Ara4N at the periplasmic surface .

  • Lipid A structural analysis: Mass spectrometry to detect the presence or absence of L-Ara4N modifications on lipid A extracted from wildtype versus arnF mutant strains .

  • Complementation assays: Similar to those used for other flippases such as Wzk, where heterologous expression of the protein is tested for its ability to restore function in deletion mutants .

  • Protein-protein interaction studies: To determine how ArnF interacts with other Arn proteins, particularly ArnE, which is believed to form a functional flippase complex with ArnF .

What are the optimal conditions for expressing recombinant ArnF in E. coli?

Based on experimental design approaches for recombinant membrane proteins in E. coli, the optimal conditions for expressing ArnF should consider:

  • Expression strain selection: Specialized E. coli strains like SuptoxR or SuptoxRNE22 have demonstrated enhanced capabilities for membrane protein expression through modifications in RNase E activity, which can suppress cytotoxicity associated with membrane protein overexpression .

  • Promoter optimization: Engineering the promoter sequence can significantly improve expression levels. Inserting additional Shine-Dalgarno (SD) sequences between the promoter and target gene has been shown to enhance expression levels of membrane proteins .

  • Temperature and induction parameters: For membrane proteins like ArnF, lower induction temperatures (16-25°C) and moderate inducer concentrations often yield better results by allowing proper folding and membrane insertion .

  • Media composition: Rich media supplemented with glycerol as a carbon source rather than glucose can enhance membrane protein expression by avoiding catabolite repression .

  • Co-expression strategies: Including molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) can improve folding and reduce aggregation of membrane proteins .

An experimental design matrix for optimizing ArnF expression might look like:

ParameterLow LevelMedium LevelHigh Level
Temperature16°C25°C37°C
IPTG concentration0.1 mM0.5 mM1.0 mM
Induction time4 hours12 hours24 hours
MediaMinimalLBTerrific Broth
StrainBL21(DE3)C41(DE3)SuptoxRNE22

These parameters should be systematically tested using a Design of Experiment (DoE) approach to determine the optimal conditions for functional ArnF expression .

How can inclusion body formation be minimized when expressing recombinant ArnF?

Inclusion body (IB) formation is a common challenge when expressing membrane proteins like ArnF. Several strategies can be implemented to minimize IB formation:

  • Slowing down translation rate: Reducing culture temperature (16-20°C) during induction phase decreases protein synthesis rate, allowing more time for proper folding and membrane insertion .

  • Genetic fusion strategies: Fusing ArnF with solubility-enhancing partners such as thioredoxin (Trx), NusA, or SUMO can improve protein folding .

  • Co-expression with folding modulators: Including folding chaperones like DsbC or Skp that specifically aid membrane protein folding .

  • Optimizing codon usage: Adapting the arnF gene sequence to match the codon bias of E. coli can improve translation efficiency and reduce ribosomal stalling that may lead to misfolding .

  • Engineering E. coli hosts: Using strains with precise domain deletions in ribonuclease E (RNase E) has shown promise in enhancing membrane protein production by reducing cytotoxicity associated with membrane protein overexpression .

  • Detergent supplementation: Adding mild detergents like CHAPS or DDM at low concentrations to the growth medium can aid in proper membrane protein folding and insertion .

Research has shown that proper implementation of these strategies can increase the yield of correctly folded membrane proteins by 5-10 fold compared to standard expression conditions .

What structural features are important for ArnF flippase activity?

While detailed crystal structures of ArnF have not been extensively reported in the provided search results, insights can be gained from studies of related flippases:

  • Transmembrane domains: ArnF is predicted to contain multiple transmembrane helices that form a channel or pore through which the undecaprenyl phosphate-alpha-L-Ara4N substrate can be flipped across the membrane .

  • ATP-binding motifs: By analogy with other flippases like Wzk, ArnF likely requires ATP hydrolysis for function. Studies on Wzk demonstrated that mutations in the ATP-binding site (such as E525A) abolished flippase activity, suggesting energy dependence for the flipping mechanism .

  • Substrate recognition regions: Specific amino acid residues are likely involved in recognizing the L-Ara4N moiety on the lipid carrier, providing specificity to the flipping process .

  • Protein-protein interaction interfaces: Since ArnF functions in conjunction with ArnE, specific structural features must facilitate their interaction to form a functional flippase complex .

Experimental approaches to identify these structural features include site-directed mutagenesis of conserved residues, chimeric protein construction with other flippases, and membrane topology mapping using reporter fusions or cysteine accessibility methods .

How does ArnF interact with other proteins in the Arn pathway?

ArnF functions as part of a complex biosynthetic pathway involving multiple Arn proteins:

  • ArnE-ArnF complex formation: ArnF (formerly PmrL) works in conjunction with ArnE (formerly PmrM) to form a functional flippase complex. Biochemical evidence suggests these proteins interact directly to facilitate the translocation of undecaprenyl phosphate-alpha-L-Ara4N across the inner membrane .

  • Interaction with biosynthetic enzymes: The Arn pathway involves ArnA through ArnT proteins that synthesize and attach L-Ara4N to lipid A. ArnF must be functionally coupled with these enzymes, particularly ArnT, which transfers the L-Ara4N moiety to lipid A on the periplasmic side .

  • Coordination with regulatory systems: The expression of the arn operon is regulated by the PmrA transcription factor, suggesting coordinated expression of all pathway components in response to environmental signals .

Research approaches to study these interactions include:

  • Bacterial two-hybrid assays to detect protein-protein interactions

  • Co-immunoprecipitation experiments with tagged ArnF

  • Blue native PAGE to identify native membrane protein complexes

  • FRET-based approaches to monitor interactions in living cells

  • Crosslinking studies to capture transient interactions between pathway components

Understanding these interactions is crucial for developing comprehensive models of lipid A modification pathways and potentially identifying targets for new antimicrobial strategies .

How can recombinant ArnF be used in drug discovery and antimicrobial resistance research?

Recombinant ArnF provides several valuable applications in drug discovery and antimicrobial resistance research:

  • Target-based screening: Purified recombinant ArnF can be used in high-throughput screening assays to identify small molecules that inhibit its flippase activity. Such inhibitors could potentially sensitize resistant bacteria to polymyxins and other cationic antimicrobial peptides .

  • Structure-based drug design: If structural data becomes available, computational approaches can be used to design inhibitors targeting specific functional domains of ArnF .

  • Resistance mechanism studies: Recombinant ArnF variants with specific mutations can help elucidate the molecular mechanisms of antimicrobial resistance and how bacteria evolve new resistance strategies .

  • Diagnostic applications: Antibodies raised against recombinant ArnF could be used to develop diagnostic tests for detecting specific resistance mechanisms in clinical isolates .

  • Combination therapy development: Understanding ArnF function can guide the development of adjuvants that block L-Ara4N modification pathways, potentially restoring effectiveness of existing antimicrobials against resistant strains .

Innovative approaches include developing lipid flippase activity assays similar to those used for the Wzk flippase, where glycosylation of reporter proteins like AcrA can be monitored as a readout of flippase function .

What experimental approaches can determine the substrate specificity of ArnF?

Determining the substrate specificity of membrane flippases like ArnF requires specialized approaches:

  • Reconstitution in artificial membrane systems: Purified ArnF can be reconstituted into liposomes with fluorescently labeled lipid substrates to directly measure translocation activities across membranes .

  • Complementation assays: Similar to experiments with Wzk flippase, heterologous expression of ArnF in strains lacking other flippases can reveal which lipid substrates it can transport . For instance, testing whether ArnF can complement E. coli strains lacking MurJ (which flips peptidoglycan precursors) would reveal potential overlapping specificities .

  • Modified substrate analysis: Synthesizing variants of undecaprenyl phosphate-alpha-L-Ara4N with chemical modifications allows researchers to determine which structural features are essential for recognition by ArnF .

  • Competition assays: Using unlabeled potential substrates to compete with a known labeled substrate can identify the range of molecules that ArnF can recognize .

  • In vivo labeling studies: As demonstrated with N-hydroxysulfosuccinimidobitin labeling, membrane-impermeable reagents can detect the presence of flipped substrates on the periplasmic side of the membrane in wildtype versus mutant strains .

A comprehensive analysis using these approaches revealed that some flippases like Wzk have relaxed substrate specificity, being able to translocate both O-antigen precursors and peptidoglycan precursors across membranes . Similar studies with ArnF could reveal whether it can transport molecules beyond undecaprenyl phosphate-alpha-L-Ara4N.

How can advanced genetic engineering improve recombinant ArnF expression and functionality?

Advanced genetic engineering approaches offer significant potential for improving recombinant ArnF expression and functionality:

  • Codon optimization algorithms: Using machine learning-based codon optimization that considers not just codon frequency but also mRNA secondary structure and ribosome binding site accessibility can enhance translation efficiency .

  • Genome engineering of host strains: Creating specialized E. coli strains with precise genomic modifications, such as the SuptoxRNE22 strain with RNase E domain deletions, has demonstrated significantly enhanced membrane protein production capacity . This strain showed "greatly enhanced levels of recombinant MP production for proteins of both prokaryotic and eukaryotic origin" and performed better than commercially available strains .

  • Promoter engineering: Developing synthetic promoters with modified -10 and -35 regions, and optimized spacer lengths can fine-tune expression levels. Inserting additional Shine-Dalgarno sequences between promoters and target genes has been shown to increase expression by enhancing translation initiation efficiency .

  • Directed evolution approaches: Creating libraries of ArnF variants and selecting for improved expression or activity can identify mutations that enhance protein stability or function without prior structural knowledge .

  • Synthetic biology circuits: Implementing feedback-regulated expression systems that respond to cellular stress markers can dynamically adjust ArnF expression rates to maximize yields while minimizing toxicity .

  • N-linked glycosylation engineering: For functional studies requiring glycosylated proteins, engineered E. coli strains with the N-glycosylation machinery from Campylobacter jejuni (including PglB transferase) can be utilized. This approach has been successful for other membrane proteins and could be adapted for ArnF studies requiring post-translational modifications .

These advanced genetic engineering strategies have shown promising results in experimental settings, with some approaches achieving 5-10 fold increases in functional membrane protein yields compared to conventional methods .

How might long-term evolution experiments inform our understanding of ArnF function and antimicrobial resistance?

Long-term evolution experiments (LTEEs) provide valuable insights into the evolutionary dynamics of bacterial functions, including antimicrobial resistance mechanisms involving ArnF:

  • Adaptive mutations: Long-term evolution experiments, similar to the E. coli LTEE that has tracked bacterial evolution for over 80,000 generations, could reveal novel adaptive mutations in arnF and related genes that enhance antimicrobial resistance . These experiments could identify previously unknown functional residues or regulatory mechanisms.

  • Evolutionary trade-offs: LTEEs can reveal potential fitness costs associated with maintaining or modifying ArnF function. For instance, while ArnF-mediated lipid A modification confers polymyxin resistance, it might have energetic costs or affect other membrane functions .

  • Compensatory mutations: When bacteria evolve under antimicrobial pressure, they often develop compensatory mutations that mitigate fitness costs of resistance. LTEEs could identify such mutations in the context of ArnF-mediated resistance .

  • Evolutionary reproducibility: By running parallel evolution experiments, researchers can determine whether similar modifications to arnF arise independently, suggesting preferred evolutionary pathways .

  • Cross-resistance patterns: LTEEs can reveal how adaptation involving ArnF might affect sensitivity to other antimicrobials, potentially uncovering novel drug combinations that prevent resistance evolution .

The E. coli LTEE has demonstrated that bacteria can evolve new metabolic capabilities over long timeframes, such as aerobic citrate utilization appearing after 31,000 generations . Similar experiments focusing on antimicrobial pressure could reveal if bacteria can evolve enhanced or novel functions for ArnF that further contribute to resistance.

What role might ArnF play in novel antimicrobial development strategies?

ArnF presents several promising avenues for novel antimicrobial development strategies:

  • Direct inhibition approach: Developing small molecules that specifically inhibit ArnF function could sensitize resistant bacteria to polymyxins and other cationic antimicrobial peptides. This approach could revitalize the use of existing antibiotics against resistant strains .

  • Combination therapy: ArnF inhibitors could serve as adjuvants alongside traditional antibiotics, creating synergistic effects that overcome resistance mechanisms .

  • Anti-virulence strategy: Rather than killing bacteria directly, targeting ArnF function could reduce bacterial survival in host environments where antimicrobial peptides are present, thereby reducing virulence without imposing strong selective pressure for resistance .

  • Diagnostic applications: Detection of ArnF expression could help identify resistant strains and guide appropriate antibiotic selection in clinical settings .

  • Structure-based vaccine development: If surface-exposed epitopes of ArnF are identified, these could potentially serve as targets for vaccine development, especially if they are conserved across multiple bacterial species .

  • Broad-spectrum applications: Given that arnF-like genes are present in multiple gram-negative pathogens, including Salmonella and E. coli, inhibitors targeting conserved regions could potentially have broad-spectrum activity .

Recent research on RNA-hydrolyzing recombinant minibodies has demonstrated successful simultaneous targeting of different viral pathogens . Similar multi-targeting approaches could be developed for bacterial resistance mechanisms, potentially targeting multiple components of the L-Ara4N modification pathway including ArnF.

How can researchers address solubility and stability issues when working with recombinant ArnF?

Membrane proteins like ArnF present significant challenges for expression and purification. Here are methodological approaches to address these issues:

  • Detergent screening: Systematically test a panel of detergents for protein extraction and stability using a thermal shift assay approach. Common detergents to test include:

    Detergent ClassExamplesStarting Concentration
    MaltosidesDDM, UDM, DM1-2× CMC
    GlucosidesOG, NG2-3× CMC
    Neopentyl glycolsLMNG, MNG-31× CMC
    ZwitterionicCHAPS, FC-121-2× CMC
    Mixed micellesDDM/CHS, LMNG/CHSAs above + 0.1% CHS
  • Fusion partner optimization: Test different fusion partners specifically beneficial for membrane proteins:

    Fusion PartnerPositionBenefits
    MBPN-terminalEnhanced solubility, affinity purification
    GFPC-terminalFolding indicator, monodispersity assessment
    SUMON-terminalImproved folding, cleavable tag
    MisticN-terminalMembrane insertion enhancement
    ThioredoxinN-terminalDisulfide bond formation
  • Buffer optimization: Develop a multifactorial screening approach for buffer conditions:

    • pH range (6.0-8.5)

    • Salt type and concentration (NaCl, KCl, 100-500 mM)

    • Glycerol content (0-20%)

    • Lipid additives (POPC, POPE, E. coli lipid extract)

    • Stabilizing agents (cholesterol hemisuccinate, specific phospholipids)

  • Construct optimization: Create truncation libraries to identify minimal functional domains with improved stability. This approach requires careful bioinformatic analysis of predicted transmembrane regions and domain boundaries .

  • Nanodiscs and SMALPs: For functional studies, reconstitute purified ArnF into nanodiscs using appropriate membrane scaffold proteins or extract directly using styrene maleic acid copolymers (forming SMALPs), which preserve the native lipid environment .

When applying these strategies, a systematic Design of Experiment (DoE) approach should be implemented to efficiently identify optimal conditions rather than varying one factor at a time .

What are the most common issues in functional assays for ArnF and how can they be addressed?

Functional characterization of membrane flippases like ArnF presents several technical challenges:

  • Detection sensitivity issues:

    • Problem: Low signal-to-noise ratio in flippase assays due to background membrane permeability.

    • Solution: Implement fluorescently labeled lipid substrates with quenchers on the opposite face of liposomes, where flipping results in fluorescence dequenching. This approach increases sensitivity by reducing background signal .

  • Reconstitution efficiency variability:

    • Problem: Inconsistent incorporation of ArnF into artificial membrane systems.

    • Solution: Standardize proteoliposome preparation using techniques like extrusion through defined-size filters and quantify protein incorporation using fluorescent tags or antibody detection methods .

  • Substrate availability:

    • Problem: Limited availability of the natural substrate undecaprenyl phosphate-alpha-L-Ara4N.

    • Solution: Develop synthetic substrate analogs with similar structural features but simplified synthesis routes, or implement in vivo complementation assays as proxy measures of function .

  • ATP dependence characterization:

    • Problem: Difficulty in establishing ATP requirements for flippase activity.

    • Solution: Utilize non-hydrolyzable ATP analogs and ATPase-deficient mutants (similar to the WzkE525A approach) to confirm energy dependence of the flipping mechanism .

  • In vivo validation challenges:

    • Problem: Connecting in vitro activity to physiological function.

    • Solution: Develop complementation assays in arnF deletion strains with phenotypic readouts such as polymyxin resistance testing or direct detection of lipid A modifications by mass spectrometry .

A robust methodological approach should combine multiple assay types:

Assay TypeMethodologyReadoutAdvantages
In vitro flippase assayReconstituted proteoliposomes with fluorescent substratesFluorescence changesDirect measurement of activity
Complementation assayExpression of ArnF variants in knockout strainsRestoration of polymyxin resistancePhysiological relevance
Substrate accumulationN-hydroxysulfosuccinimidobitin labelingPeriplasmic substrate detectionAssesses in vivo flipping
Lipid A analysisMass spectrometryDetection of L-Ara4N modificationsDirect analysis of end product

Combining these approaches provides multiple lines of evidence for ArnF function and addresses the limitations inherent to any single assay system .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.