Recombinant Escherichia coli O8 Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Biological Functions

YciB is integral to cell envelope synthesis and division:

Cell Division and Morphology

  • Interaction with Division Machinery: Directly binds ZipA, a key cell division protein, influencing septum localization and cell length regulation .

    • Deletion of yciB shortens cell length, while overexpression causes elongation .

  • Membrane Homeostasis: Synergizes with lipoprotein DcrB to maintain lipid bilayer integrity. Double deletion (yciB dcrB) disrupts lipoprotein maturation, leading to toxic peptidoglycan-inner membrane linkages .

Stress Response

  • Osmolarity Sensitivity: ΔyciB mutants exhibit heightened susceptibility to low osmolarity, indicating compromised cell wall integrity .

  • Envelope Stress Pathways: Activates Cpx and Rcs signaling systems under membrane stress .

Applications in Research

  • Cell Division Studies: Used to dissect interactions between division proteins (e.g., ZipA) and the cell envelope .

  • Membrane Homeostasis Models: Critical for investigating lipid bilayer dynamics and lipoprotein trafficking .

  • Stress Response Pathways: Serves as a tool to study Cpx/Rcs activation under envelope stress .

Production and Purification Challenges

  • Expression Optimization: Requires precise control to avoid toxicity from overexpression, which disrupts cell morphology .

  • Storage Stability: Glycerol-based buffers prevent aggregation but limit long-term storage at 4°C .

Future Research Directions

  • Mechanistic Role in Lipid Metabolism: Clarify YciB’s impact on membrane fluidity and Lgt enzyme efficiency .

  • Therapeutic Targeting: Explore YciB-DcrB synergy as a vulnerability in pathogenic E. coli strains .

  • Structural Biology: Resolve high-resolution structures to map interaction interfaces with ZipA and other partners .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; ECIAI1_1274; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQPVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
Uniprot No.

Target Background

Function
Plays a role in cell envelope biogenesis, maintenance of cell envelope integrity, and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the membrane topology of YciB in E. coli?

YciB is predicted to be a multi-pass inner membrane protein containing five transmembrane domains. This topology has been experimentally verified using the dual pho-lac reporter system, which can determine whether protein segments reside in the cytoplasm or periplasm . The experimental approach involves creating fusion proteins with reporter enzymes alkaline phosphatase (PhoA) and β-galactosidase (LacZ), whose activities depend on their cellular localization. This methodology enables researchers to map the orientation of each transmembrane segment and determine which portions of YciB face the cytoplasm versus the periplasm.

What cellular processes is YciB involved in?

YciB participates in several critical cellular processes related to bacterial envelope integrity. It is required for normal biofilm formation, a complex bacterial community structure dependent on proper envelope composition . YciB also interacts genetically with rodZ, a gene important for maintaining rod-type morphology in E. coli . Additionally, YciB appears to be involved in cell envelope synthesis through its interactions with both cell elongation and division protein complexes . Experimental evidence suggests that YciB's role in these processes may be particularly important under specific environmental conditions, such as low osmolarity.

Which proteins does YciB interact with?

YciB interacts with a network of proteins involved in two major cellular processes:

Protein ComplexInteracting PartnersCellular Function
Cell ElongationRodZ, MreB, RodAMaintaining rod-shaped morphology and cell wall synthesis during growth
Cell DivisionFtsI, FtsQSeptum formation and cell division

These interactions have been identified using bacterial two-hybrid systems, which detect protein-protein interactions by reconstituting a functional transcriptional activator when bait and prey proteins interact . The range of YciB's interaction partners suggests it may serve as a connector between elongation and division machinery.

What phenotypes are associated with yciB deletion?

Deletion of the yciB gene leads to several observable phenotypes:

  • Increased susceptibility to low osmolarity environments

  • Impaired biofilm formation

  • Activation of envelope stress response pathways, particularly a 3-fold increase in Cpx activation

  • Synthetic lethality when combined with dcrB deletion under low-salt conditions

These phenotypes are consistent with a role for YciB in maintaining envelope integrity. When studying these phenotypes, researchers should employ controls including complementation experiments with plasmid-expressed wild-type YciB to confirm specificity of the observed effects.

What is the molecular basis of the synthetic lethality between yciB and dcrB mutations?

The synthetic lethality observed between yciB and dcrB mutations has been traced to a specific molecular mechanism involving lipoprotein processing. In yciB dcrB double mutants, the major outer membrane lipoprotein Lpp abnormally accumulates at the inner membrane, where it forms toxic linkages to peptidoglycan . This mislocalization appears to result from inefficient lipid modification during the first step of lipoprotein maturation, which is catalyzed by the phosphatidylglycerol:preprolipoprotein diacylglyceryl transferase, Lgt .

Several lines of evidence support this mechanism:

  • Deletion of lpp rescues the synthetic lethality

  • Removal of Lpp-peptidoglycan linkages alleviates toxicity

  • Increased expression of Lgt restores viability

  • Both Cpx and Rcs stress response systems are upregulated in the double mutant

Researchers investigating this phenomenon should monitor lipoprotein processing efficiency using pulse-chase experiments with radiolabeled amino acids combined with immunoprecipitation to track the maturation of Lpp precursors.

How does YciB contribute to cell envelope integrity?

YciB contributes to envelope integrity through multiple mechanisms:

  • Proper lipoprotein trafficking: YciB appears to influence the efficiency of lipoprotein maturation, particularly under stress conditions . When YciB is absent (especially in combination with dcrB deletion), lipoprotein processing by Lgt becomes compromised.

  • Interaction with cell wall synthesis machinery: YciB interacts with both elongation and division proteins involved in peptidoglycan synthesis . These interactions may coordinate envelope growth during cell expansion and division.

  • Membrane homeostasis: Evidence suggests YciB may influence membrane fluidity or lipid composition, as altered membrane properties appear to underlie the lipoprotein maturation defects in the yciB dcrB double mutant .

To experimentally assess YciB's contribution to envelope integrity, researchers should combine genetic approaches (synthetic genetic arrays) with biochemical analyses of membrane composition and biophysical measurements of membrane properties.

What stress response pathways are activated in yciB mutants?

YciB deletion activates specific envelope stress response pathways:

Stress Response PathwayActivation Level in yciB MutantDetection Method
Cpx~3-fold increasecpxP-lacZ reporter activity
RcsMinimal activation in single mutantrprA-lacZ reporter activity
σEActivated in yciB dcrB double mutantMeasured through MicL-regulated Lpp levels

The Cpx activation in yciB single mutants can be partially reduced by Lgt overexpression, suggesting that even in the absence of dcrB deletion, YciB influences lipoprotein processing to some degree . For experimental approaches, researchers should employ reporter fusions to monitor stress response activation and complement with western blotting for stress-responsive proteins.

How does YciB relate to lipoprotein maturation and trafficking?

While YciB does not directly catalyze lipoprotein maturation, it appears to influence this process indirectly:

  • In yciB dcrB double mutants, the first step of lipoprotein maturation (Lgt-mediated transacylation) is impaired

  • This impairment is not due to decreased phosphatidylglycerol levels but may relate to altered membrane fluidity or lipid homeostasis

  • Lgt overexpression can partially rescue the defects associated with yciB deletion

To investigate these relationships, researchers should employ lipoprotein pulse-chase experiments, membrane fluidity measurements (using fluorescence anisotropy or electron paramagnetic resonance spectroscopy), and lipidomic analyses to characterize changes in membrane composition in yciB mutants.

What techniques are used to study YciB membrane topology?

The membrane topology of YciB can be investigated using several complementary approaches:

  • Dual pho-lac reporter system: This system exploits the differential activity of alkaline phosphatase (PhoA) and β-galactosidase (LacZ) in different cellular compartments . PhoA is active only in the periplasm, while LacZ functions only in the cytoplasm. By creating fusion proteins with these reporters at different positions in YciB and assessing enzyme activity, researchers can determine which segments reside in which compartment.

  • Cysteine accessibility methods: By introducing cysteine residues at specific positions and testing their accessibility to membrane-permeable versus impermeable sulfhydryl reagents, researchers can map which segments are exposed to which compartment.

  • Protease protection assays: Limited proteolysis of spheroplasts or inverted membrane vesicles can identify protected segments, providing information about membrane topology.

These approaches should be combined for the most reliable topology model, as each method has distinct limitations and advantages.

How can protein-protein interactions of YciB be investigated?

Several methods can be employed to study YciB's protein interactions:

  • Bacterial two-hybrid (BACTH) system: This approach has already identified interactions between YciB and cell elongation/division proteins . The method involves fusing proteins of interest to complementary fragments of adenylate cyclase and monitoring reconstitution of activity.

  • Co-immunoprecipitation: Using antibodies against YciB or epitope-tagged versions, researchers can pull down protein complexes and identify interaction partners by mass spectrometry.

  • In situ crosslinking: Chemical crosslinkers can capture transient interactions in living cells, which can then be identified by immunoblotting or mass spectrometry.

  • Fluorescence resonance energy transfer (FRET): By tagging YciB and candidate interaction partners with appropriate fluorophores, researchers can detect interactions through energy transfer between the fluorophores when proteins come into proximity.

When applying these methods, controls should include known non-interacting proteins and demonstration that the tags do not interfere with protein function.

What genetic approaches can be used to study YciB function?

Several genetic strategies can illuminate YciB's functional roles:

  • Synthetic genetic arrays: Systematic combination of yciB deletion with mutations in other genes can identify functional relationships. The synthetic lethality with dcrB deletion was discovered through such approaches .

  • Suppressor screens: Identification of mutations that suppress phenotypes of yciB deletion can reveal downstream pathways. For example, skp deletion suppresses yciB dcrB synthetic lethality through the σE-MicL-Lpp regulatory loop .

  • Site-directed mutagenesis: Creating specific mutations in conserved residues of YciB can identify functionally important domains and residues.

  • Conditional depletion systems: For essential functions or synthetic lethal combinations, conditional expression systems (e.g., tetracycline-regulated promoters) allow controlled depletion of YciB to observe acute effects.

When implementing these approaches, researchers should verify mutant construction using multiple methods (PCR, sequencing) and validate phenotypes with complementation tests.

How can peptidoglycan synthesis be monitored in yciB mutants?

Peptidoglycan synthesis can be visualized and quantified using fluorescent probes:

  • NADA (noncanonical D-amino acid): This fluorescent D-alanine analog incorporates into previously synthesized peptidoglycan in living bacteria . It allows visualization of existing peptidoglycan structure.

  • EDA-DA (ethynyl-D-alanyl-D-alanine): This modified D-amino acid dipeptide incorporates specifically into newly synthesized peptidoglycan . It provides information about active sites of peptidoglycan synthesis.

By applying these probes to wild-type and yciB mutant cells, researchers can assess both defects in peptidoglycan structure and alterations in the pattern of synthesis. In yciB dcrB double mutants, these approaches have revealed fewer labeled septa in elongated cells and aberrant or incomplete septum formation .

How to interpret stress response activation data in yciB mutants?

When analyzing stress response activation in yciB mutants, researchers should consider:

  • Baseline controls: Always compare to both wild-type and appropriate single mutant controls to distinguish additive from synergistic effects.

  • Multiple stress response pathways: Measure activation of multiple pathways (Cpx, Rcs, σE) as different pathways respond to distinct envelope stresses.

  • Quantification methods: For reporter fusions (e.g., cpxP-lacZ), calculate fold-changes relative to wild-type under identical conditions and perform statistical analysis across multiple biological replicates.

  • Growth phase effects: Stress response activation can vary with growth phase; standardize measurements at consistent culture densities.

  • Media dependence: The yciB phenotypes show media dependence (particularly salt concentration) ; test multiple conditions to fully characterize the stress response.

The fact that yciB single mutants show Cpx activation (~3-fold) but minimal Rcs activation suggests specific rather than general envelope stress , which should inform interpretation of the underlying defects.

What controls should be included when studying synthetic lethal interactions with yciB?

When investigating synthetic lethality involving yciB, essential controls include:

  • Complementation tests: Expressing wild-type yciB from a plasmid should restore viability to the synthetic lethal combination.

  • Media variation: Test synthetic lethality across different media compositions, as the yciB dcrB synthetic lethality is conditional on salt concentration .

  • Individual gene deletions: Always characterize single mutants thoroughly to distinguish synthetic from additive effects.

  • Suppressor mutation analysis: Verify that suppressors of synthetic lethality (e.g., lpp deletion) do not themselves cause growth defects that might mask the original phenotype.

  • Pathway-specific reporters: Include reporters for relevant stress pathways (Cpx, Rcs, σE) to correlate viability with stress response activation.

When analyzing suppression mechanisms, distinguish between direct suppressors (those that address the primary defect) and indirect suppressors (those that alleviate consequences of the primary defect). For example, skp deletion suppresses yciB dcrB synthetic lethality indirectly through the σE-MicL-Lpp regulatory loop .

How to distinguish direct and indirect effects of YciB deletion?

Distinguishing primary from secondary effects of yciB deletion requires:

  • Temporal analysis: Use conditional expression systems to observe early consequences of YciB depletion before secondary effects accumulate.

  • Suppressor analysis: If a specific defect is primary, targeted suppression of that defect should alleviate all downstream consequences.

  • Biochemical assays: Direct involvement in a process typically involves physical interactions or enzymatic activities that can be measured biochemically.

  • Structure-function analysis: Mutations in different domains of YciB may separate its different functions if it has multiple roles.

  • Comparative analysis across conditions: Primary defects should be observable across different growth conditions, while secondary consequences may be condition-dependent.

In the case of YciB, evidence suggests its effects on lipoprotein processing are likely indirect, mediated through alterations in membrane properties that affect Lgt function . This interpretation is supported by the partial rescue by Lgt overexpression and the link to membrane fluidity suggested by cold sensitivity of dcrB mutations .

What are the unresolved questions about YciB function?

Several key questions about YciB remain unanswered:

  • Biochemical function: The precise biochemical activity of YciB remains unknown. Does it have enzymatic activity, serve as a scaffold, or function as a transporter?

  • Regulation: How is YciB expression and activity regulated in response to different environmental conditions?

  • Direct interactors: While YciB interacts with cell elongation and division proteins, the specific direct binding partners and the nature of these interactions remain incompletely characterized.

  • Membrane effects: How exactly does YciB influence membrane properties, and how do these changes affect lipoprotein processing enzymes like Lgt?

  • Species specificity: Does YciB function similarly across different bacterial species, or have species-specific adaptations occurred?

Addressing these questions will require integrated approaches combining structural biology, biochemistry, genetics, and cellular imaging.

How might new technologies advance our understanding of YciB?

Emerging technologies that could provide insights into YciB function include:

  • Cryo-electron tomography: This technique could visualize YciB in its native membrane context and its relationship to division and elongation complexes.

  • Native mass spectrometry: Advances in membrane protein mass spectrometry could identify YciB-containing complexes and associated lipids.

  • CRISPR interference screens: CRISPRi libraries could identify additional genetic interactions with yciB across the genome with higher precision than traditional genetic screens.

  • Super-resolution microscopy: Techniques like PALM/STORM could track YciB localization relative to other division and elongation proteins with nanometer precision.

  • Membrane microdomain analysis: New methods to isolate and characterize bacterial membrane microdomains could reveal how YciB influences membrane organization.

These approaches would complement existing genetic and biochemical studies to provide a more comprehensive understanding of YciB's roles in bacterial physiology.

What is the evolutionary significance of YciB across bacterial species?

Understanding the evolutionary context of YciB involves:

  • Comparative genomics: Analysis of YciB homologs across bacterial phyla can reveal conserved domains and species-specific adaptations.

  • Co-evolution analysis: Identifying proteins that co-evolve with YciB can suggest functional relationships conserved through evolution.

  • Phylogenetic profiling: Correlation between the presence/absence of YciB and specific bacterial traits or environmental niches could provide functional insights.

  • Horizontal gene transfer analysis: Determining whether yciB has been subject to horizontal transfer could indicate adaptability to different cellular contexts.

  • Experimental evolution: Laboratory evolution experiments under different selective pressures could reveal how YciB function adapts to changing environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.