Recombinant Escherichia coli O8 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Significance

Lgt is indispensable for bacterial survival, as demonstrated by the lethality of lgt gene deletion in E. coli . It recognizes the "lipobox" motif (consensus sequence LVIASTVIGASC(+1)) in prolipoproteins and transfers the diacylglyceryl moiety from phosphatidylglycerol (PG) to the thiol group of the cysteine residue . This modification anchors lipoproteins to the membrane, enabling their roles in nutrient uptake, cell envelope integrity, and virulence.

Key functional features:

  • Substrate specificity: Lgt binds PG in two distinct sites, facilitating sequential substrate movement during catalysis .

  • Inhibition susceptibility: Macrocyclic inhibitors (e.g., G2823 and G2824) target Lgt, causing bactericidal effects by disrupting lipoprotein maturation .

Essential Residues and Catalytic Mechanism

Mutagenesis studies identify residues critical for Lgt activity:

Table 2: Functionally Essential Residues in E. coli Lgt

ResidueRoleImpact of MutationSource
R143Activates C3–O ester bond of PGLoss of diacylglyceryl transfer
R239Stabilizes substrate via H-bond networkComplete inactivation
Y26, N146Structural integrity of TM domainsNon-functional enzyme
E243, R246Forms periplasmic H-bond networkReduced catalytic efficiency

The proposed mechanism involves:

  1. PG binding to the first site, followed by lateral movement into the second site.

  2. Nucleophilic attack by the lipobox cysteine on the activated diacylglyceryl group.

  3. Release of the lipid-modified lipoprotein through the periplasmic cleft .

4.1. Expression Systems

  • Complementation assays: E. coli lgt-knockout strains are rescued by plasmid-borne lgt from Vibrio cholerae, enabling temperature-dependent selection .

  • In vitro assays: A GFP-based system (lipoGFP substrate) quantifies Lgt activity by monitoring diacylglyceryl transfer .

4.2. Biotechnological Uses

  • Antibiotic-free plasmid maintenance: lgt complementation stabilizes expression vectors without antibiotic resistance genes .

  • Drug discovery: High-throughput screening identifies Lgt inhibitors with bactericidal activity .

Pathogenic Context of E. coli O8

While the O8 serotype is associated with diarrheal outbreaks due to enterotoxins (e.g., LT2d) , no direct link between O8 and recombinant Lgt production exists in current literature. Most Lgt studies use laboratory E. coli strains (e.g., K-12 or BL21), not pathogenic O8 isolates.

Research Gaps and Future Directions

  • Structural dynamics: Real-time tracking of substrate movement within Lgt’s central cavity.

  • O8-specific studies: Investigating lipoprotein processing in pathogenic E. coli O8 strains.

  • Therapeutic targeting: Optimizing Lgt inhibitors for Gram-negative pathogens .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; ECIAI1_2936; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPQFMAEPLYLFRVWDGGMSFHGGLIGVIVVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAMLFPGSRTEDILLLQTN PQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSPQQHVS
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lgt and what is its role in bacterial physiology?

Prolipoprotein diacylglyceryl transferase (Lgt) is an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification pathway essential for bacterial lipoprotein biogenesis. In this reaction, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in the "lipobox" of prolipoproteins, initiating the lipid modification process. This modification is crucial for proper localization and anchoring of lipoproteins to bacterial membranes . The process is fundamental to bacterial survival as lipoproteins fulfill diverse and vital biological functions including maintenance of cell envelope architecture, insertion and stabilization of outer membrane proteins, nutrient uptake, transport, adhesion, invasion, and virulence . The essentiality of this enzyme is underscored by the fact that deletion of the lgt gene is lethal to most Gram-negative bacteria, making it indispensable for bacterial viability .

Which residues are critical for Lgt catalytic activity and how were they identified?

Several residues have been identified as critical for Lgt catalytic activity through a combination of structural analysis, site-directed mutagenesis, and complementation studies in lgt-knockout strains. Key residues include Arg143 and Arg239, which are essential for diacylglyceryl transfer, as demonstrated by complementation experiments using various Lgt mutants in lgt-deficient strains . Additional critical residues include Y26 (located in TM-1), G98 (between arm-2 and TM-3), G104 (in TM-3), H103 (implicated in substrate specificity), N146 (in TM-4), G154 (in the loop between TM-4 and head domain), and E151 (also in the loop between TM-4 and head domain) . These residues were identified through systematic mutation studies where variants with substitutions at these positions either failed to complement lgt-deficient strains or showed impaired growth patterns. For example, Lgt variants with Y26A, R143A, N146A, G154A, and R239A mutations were unable to restore growth in lgt-deficient strains, whereas variants with G98A, G104A, and E151A substitutions exhibited delayed growth . The H103Q variant showed an interesting phenotype where cells grew to mid-exponential phase but then exhibited rapid lysis, suggesting a critical role in enzyme stability or function .

Why is the lgt gene considered essential in most Gram-negative bacteria?

The lgt gene is considered essential in most Gram-negative bacteria due to its critical role in lipoprotein biosynthesis, which is fundamental to bacterial envelope integrity and function. Lipoproteins modified by Lgt play vital roles in cell envelope architecture, stabilization of outer membrane proteins, nutrient uptake, transport mechanisms, and virulence . Deletion of the lgt gene is lethal in Escherichia coli and other Gram-negative organisms as demonstrated by multiple complementation studies . The essentiality of lgt stems from the fact that without proper lipoprotein modification, Gram-negative bacteria cannot maintain their cell envelope integrity, leading to compromised barrier function, impaired transport systems, and ultimately cell death. This essential nature is further evidenced by studies showing that lgt-deleted strains can only survive when complemented with a functional lgt gene provided in trans on a plasmid . The lethal phenotype observed upon lgt deletion has been leveraged to develop novel selection systems for recombinant protein production, underscoring both its essentiality and biotechnological significance .

How can researchers establish an lgt-based selection system for recombinant protein expression?

Establishing an lgt-based selection system for recombinant protein expression involves a sophisticated genetic engineering approach that eliminates the need for antibiotic resistance markers. The methodology requires several key steps: First, researchers must delete the chromosomal lgt gene from the host strain (e.g., E. coli BL21) using targeted gene replacement techniques such as homologous recombination with a suicide vector . This deletion is complemented by providing a functional lgt gene on a temperature-sensitive maintenance plasmid that allows cell growth at permissive temperatures (30°C) but not at restrictive temperatures (37°C or above). Next, researchers must construct an expression vector carrying both the gene of interest and a temperature-insensitive version of the lgt gene from a different bacterial species (e.g., Vibrio cholerae) to ensure functionality at higher temperatures . Upon transformation, selection is achieved by incubating at restrictive temperatures (e.g., 39°C), where only cells containing the expression plasmid with the functional lgt gene survive . The expression of recombinant proteins can then be controlled using conventional induction systems such as IPTG-inducible promoters. This system confers extreme plasmid stability without requiring antibiotics, as plasmid loss becomes lethal to the host cell. The method has been successfully applied to express both soluble proteins and those forming inclusion bodies, demonstrating its versatility for different protein types .

What structural and biochemical techniques are most effective for studying Lgt function?

Studying Lgt function effectively requires a complementary combination of structural and biochemical techniques. X-ray crystallography has proven invaluable for determining high-resolution structures of Lgt in complex with substrates (phosphatidylglycerol) and inhibitors (palmitic acid), providing critical insights into binding sites and catalytic mechanisms . For functional analysis, site-directed mutagenesis coupled with complementation assays in lgt-knockout strains has been particularly effective in identifying essential residues and elucidating structure-function relationships . GFP-based in vitro assays have successfully correlated enzyme activities with structural observations, enabling quantitative assessment of wild-type and mutant Lgt variants . Large-scale sequence analysis across bacterial species has facilitated the definition of conserved motifs (such as the 13-residue Lgt motif) and the identification of species-specific variations that may impact substrate specificity . Biochemical characterization through enzyme activity assays using purified components has helped delineate reaction mechanisms and kinetic parameters. Additionally, in vivo studies examining the consequences of mutations on bacterial growth, complementation efficiency, and lipoprotein processing have provided functional insights under physiologically relevant conditions. For studying membrane proteins like Lgt, techniques such as detergent solubilization, membrane reconstitution, and microscale thermophoresis have proven valuable for examining substrate interactions in environments mimicking the native membrane context.

How can researchers design experiments to analyze substrate specificity of different Lgt homologs?

Designing experiments to analyze substrate specificity of different Lgt homologs requires a multifaceted approach that combines genetic, biochemical, and structural methodologies. Researchers should first perform comprehensive phylogenetic analysis to identify evolutionarily diverse Lgt homologs from various bacterial species, with particular attention to pathogenic organisms where substrate specificity may impact virulence . Heterologous expression systems can then be established by complementing lgt-deleted strains with different homologs to assess cross-species functionality . To directly examine substrate specificity, researchers should develop in vitro assay systems using purified enzymes and synthetic peptide substrates based on different lipobox sequences to quantify reaction rates and substrate preferences. Comparative structural studies, including co-crystallization with different substrate analogs, can provide insights into the molecular basis of specificity differences . Site-directed mutagenesis targeting regions likely involved in substrate recognition (particularly in the arm and head domains) should be performed, followed by activity assays to assess changes in specificity profiles . Exchange of specific domains between Lgt homologs (domain swapping) can help identify the structural elements responsible for substrate discrimination. Advanced techniques like hydrogen-deuterium exchange mass spectrometry can map dynamic protein-substrate interactions. Additionally, bioinformatic approaches combining sequence analysis with structural modeling can predict specificity-determining residues for experimental validation. For biologically relevant assessment, researchers should analyze the processing of endogenous lipoproteins in cells expressing different Lgt homologs using proteomics approaches to identify differences in the repertoire of modified proteins.

What methodologies can be applied to screen for potential Lgt inhibitors?

Screening for potential Lgt inhibitors requires sophisticated methodologies spanning computational, biochemical, and cellular approaches. High-throughput biochemical assays using purified Lgt and fluorescently labeled substrate analogs can serve as primary screens to identify compounds that inhibit enzymatic activity . Crystal structures of Lgt bound to its natural substrate and known inhibitors (such as palmitic acid) provide templates for structure-based virtual screening and rational design of novel inhibitors targeting the active site or substrate binding pockets . Fragment-based drug discovery approaches, utilizing biophysical methods like surface plasmon resonance or thermal shift assays, can identify small molecules that bind to Lgt and can be elaborated into more potent inhibitors. Whole-cell screening using lgt-conditional strains, where growth is dependent on Lgt function, offers a physiologically relevant system to identify compounds with cellular activity and adequate penetration of bacterial membranes. Competitive binding assays with radiolabeled or fluorescently tagged substrates can directly measure displacement by potential inhibitors. Time-resolved crystallography methods may capture intermediate states during catalysis, providing additional targets for inhibitor design. Metabolic labeling approaches tracking lipoprotein modification in cells treated with candidate inhibitors can validate target engagement in intact bacteria. For advanced screening, differential screening against Lgt homologs from different bacterial species can identify species-selective inhibitors with potential as narrow-spectrum antibiotics . Medicinal chemistry optimization of hit compounds, guided by structure-activity relationships, can improve potency, selectivity, and pharmacokinetic properties of promising Lgt inhibitors.

How do the arm and head domains of Lgt determine substrate specificity across bacterial species?

The arm and head domains of Lgt play crucial roles in determining substrate specificity across bacterial species through specific structural and functional adaptations. Recent research indicates that these domains, which show greater sequence variability compared to the highly conserved catalytic core, contribute significantly to the recognition and processing of different prolipoproteins . The arm domains (particularly arm-2) together with histidine 103 have been identified as determinants of protein substrate specificity, likely forming part of the binding interface that recognizes the lipobox motif in prolipoproteins . Structural analyses reveal that these domains create species-specific binding pockets with different electrostatic and hydrophobic properties that accommodate variations in the lipobox sequences of different bacterial species. The positioning of these domains relative to the transmembrane regions facilitates the lateral entry of substrate prolipoproteins into the active site while maintaining specificity. Comparative analyses of Lgt homologs from different pathogens have highlighted how subtle variations in these domains correlate with differences in substrate processing efficiency and specificity . These structural differences may reflect evolutionary adaptations to the specific repertoire of lipoproteins required by different bacterial species for survival in their respective ecological niches. The understanding of how arm and head domains determine substrate specificity has significant implications for developing species-specific inhibitors targeting Lgt in pathogenic bacteria, potentially leading to narrow-spectrum antibiotics with reduced impact on beneficial microbiota .

What is the proposed catalytic mechanism of Lgt and how has it evolved among bacterial species?

The catalytic mechanism of Lgt involves a sophisticated coordination of substrate binding and chemical transformation that has been refined through bacterial evolution. Based on structural and biochemical studies, a refined catalytic mechanism has been proposed where Lgt facilitates the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the conserved cysteine residue in the lipobox of prolipoproteins . Critical catalytic residues, including Arg143 and Arg239, form essential interactions with the phosphate group of phosphatidylglycerol, properly positioning it for nucleophilic attack by the cysteine thiol of the prolipoprotein . Recent large-scale sequence analysis has led to the definition of a 13-residue Lgt motif that encapsulates the core catalytic machinery conserved across bacterial species . Evolutionary analysis suggests that the fundamental catalytic mechanism is highly conserved, reflecting the essential nature of this enzymatic function, while peripheral domains have diverged to accommodate species-specific substrate preferences . The proposed mechanism involves lateral access of both substrates (phosphatidylglycerol and prolipoprotein) to the active site from within the membrane bilayer, consistent with the membrane-embedded nature of the reaction components . Studies of Lgt homologs from different bacterial species reveal conservation of key catalytic residues while showing variations in substrate binding regions, suggesting that evolution has preserved the core reaction chemistry while allowing adaptation to different lipoprotein repertoires . This evolutionary pattern has implications for understanding bacterial adaptation and for developing inhibitors that can selectively target Lgt in specific pathogens.

How does the structure of Lgt accommodate the membrane environment and substrate accessibility?

The structure of Lgt has evolved sophisticated adaptations to accommodate its membrane environment while ensuring substrate accessibility for catalysis. X-ray crystallography studies have revealed that Lgt possesses multiple transmembrane helices that anchor the enzyme within the lipid bilayer, positioning the active site optimally for accessing both the phospholipid and prolipoprotein substrates . A key feature of Lgt's architectural design is its ability to facilitate lateral entry of substrates directly from the membrane, rather than requiring them to exit the hydrophobic environment . This lateral access mechanism is supported by the presence of specific structural features that create an opening in the protein facing the lipid bilayer. The enzyme contains two distinct binding sites: one for phosphatidylglycerol and another for the prolipoprotein substrate, both positioned to allow membrane-embedded substrates to access the catalytic center without leaving their native environment . The arrangement of transmembrane helices creates a protected catalytic pocket while still allowing the necessary flexibility for substrate binding and product release. The arm domains extend into the membrane region, likely facilitating the recruitment and proper orientation of substrates approaching from within the bilayer . Additionally, the structural organization ensures that the catalytic residues are positioned at the interface between hydrophobic and hydrophilic environments, appropriate for the chemistry involved in the transfer reaction. This sophisticated structural accommodation of the membrane environment is essential for Lgt function and represents a remarkable example of enzyme adaptation to the constraints of membrane-associated catalysis.

How can the lgt system be utilized as an antibiotic-free selection marker for recombinant protein production?

The lgt system offers a sophisticated antibiotic-free selection approach for recombinant protein production that addresses several limitations of conventional antibiotic-based selection methods. Implementation begins with the construction of an lgt-deleted bacterial strain (e.g., E. coli BL21 Δlgt) where the chromosomal lgt gene is precisely removed and initially complemented with a temperature-sensitive plasmid carrying a functional lgt gene . The expression vector is then engineered to contain both the gene of interest under a suitable promoter (e.g., tac promoter) and a temperature-insensitive version of the lgt gene, typically from a different bacterial species to avoid recombination with any residual homologous sequences . Upon transformation into the lgt-deleted host, selection occurs naturally at non-permissive temperatures (e.g., 39°C) where only transformants harboring the functional lgt-containing expression vector can survive . The system confers extreme plasmid stability without antibiotic pressure because plasmid loss becomes lethal to the host cell. This approach offers several advantages: it eliminates the need for antibiotics in production processes, thereby reducing antibiotic residues in the final product; it prevents the release of antibiotic resistance genes into the environment; it reduces production costs associated with antibiotics; and it maintains high plasmid stability even during long-term cultures . The system has been successfully demonstrated for the expression of diverse proteins, including both soluble proteins and those forming inclusion bodies, with yields comparable to conventional antibiotic-based systems . Furthermore, this methodology can be readily transferred to other Gram-negative bacterial species, expanding its utility across different expression hosts .

What considerations are important when designing cross-species complementation experiments with lgt genes?

Designing effective cross-species complementation experiments with lgt genes requires careful consideration of multiple factors to ensure meaningful results. Researchers must first evaluate the evolutionary relationship and sequence similarity between the donor and recipient lgt genes to assess potential functional compatibility . Codon optimization of the donor lgt gene for expression in the recipient organism may be necessary to ensure efficient translation, particularly when working with species having significantly different GC content or codon usage patterns . Expression level control is critical, as both insufficient expression (failing to complement the deletion) and overexpression (potentially toxic) can negatively impact results; using inducible or constitutive promoters of appropriate strength is essential . The experimental design should include appropriate controls, including positive controls with the native lgt gene and negative controls lacking complementation . Temperature sensitivity must be considered, as lgt genes from different species may have different temperature optima that affect complementation efficiency at various growth temperatures . Researchers should assess growth kinetics, not just endpoint viability, as cross-species complementation may result in altered growth rates or lag phases even when supporting survival . Functional validation should extend beyond growth complementation to include assessment of lipoprotein modification efficiency using biochemical assays or reporter systems . Structural compatibility between the donor Lgt and host membrane environment should be considered, as membrane composition differences may affect enzyme insertion and activity . For applications in recombinant protein production, researchers should evaluate plasmid stability over extended cultivation periods and under various growth conditions to ensure reliable performance . Additionally, potential metabolic burden from expression of heterologous lgt should be assessed, particularly when coupled with high-level expression of recombinant proteins .

How can the lgt system be scaled up for industrial-level recombinant protein production?

Scaling up the lgt system for industrial-level recombinant protein production requires systematic optimization across multiple parameters to ensure robust performance at larger scales. The fundamental approach involves expanding the laboratory-proven lgt complementation system while addressing challenges specific to industrial bioprocessing . First, strain engineering must be refined to ensure genomic stability of the lgt deletion over extended cultivation periods, potentially incorporating additional genomic modifications to enhance productivity and stability . Expression vector design should be optimized for industrial applications, balancing lgt expression levels against recombinant protein production to avoid metabolic burden while maintaining plasmid retention . Process development requires careful optimization of fermentation parameters including temperature control (critical for temperature-based selection systems), media composition (avoiding components that might interfere with lgt-based selection), and feeding strategies to maintain high cell densities without compromising plasmid stability . Scale-up validation should proceed through incremental volume increases (laboratory to pilot to production scale), with careful monitoring of growth kinetics, plasmid stability, and product yield at each stage . The system has demonstrated scalability potential, with successful implementation in 3-liter fermenters and theoretical potential for further scaling to industrial levels (e.g., 500-liter scale) based on experience with similar systems . Downstream processing may benefit from the absence of antibiotics, potentially simplifying purification workflows while meeting regulatory requirements for absence of antibiotic residues. Quality control protocols should be established to monitor consistency of the lgt-based selection system across production batches, including assessment of plasmid retention rates and recombinant protein quality . Regulatory considerations may favor this antibiotic-free selection system, particularly for pharmaceutical applications where antibiotic residues are problematic . Finally, the system's adaptability to different Gram-negative bacterial hosts provides flexibility in choosing production organisms optimized for specific recombinant proteins .

What potential exists for developing Lgt-targeted antimicrobials with narrow-spectrum activity?

The potential for developing Lgt-targeted antimicrobials with narrow-spectrum activity represents an exciting frontier in antibacterial drug discovery. Lgt's essential nature in most Gram-negative bacteria, combined with its accessibility to drugs due to membrane-exposed domains, positions it as a promising target for novel therapeutics . The observed structural and functional differences in the arm and head domains of Lgt across bacterial species provide a molecular basis for developing compounds with species-selective inhibition profiles . Structure-based drug design approaches, leveraging high-resolution crystal structures of Lgt from different pathogens, could enable the rational design of inhibitors that exploit species-specific binding pocket variations . Computational approaches combining homology modeling with virtual screening may accelerate the identification of compounds with predicted selective activity profiles. Fragment-based drug discovery methodologies focused on the distinctive regions of Lgt could yield starting points for species-selective inhibitors. The 13-residue Lgt motif recently defined through large-scale sequence analysis provides a template for designing inhibitors targeting the conserved catalytic machinery while exploiting peripheral differences for selectivity . Natural product screening, particularly focusing on lipid-like molecules that may interact with the phospholipid binding site, represents another avenue for discovering novel scaffolds with Lgt inhibitory activity. Developing high-throughput screening platforms capable of testing compounds against Lgt homologs from multiple bacterial species in parallel would facilitate the identification of narrow-spectrum candidates. Collaborative approaches combining medicinal chemistry, structural biology, and microbiology will be essential for advancing promising leads through optimization to address pharmacokinetic challenges associated with targeting membrane proteins while maintaining selective activity profiles.

How might advanced structural biology techniques further elucidate Lgt conformational dynamics during catalysis?

Advanced structural biology techniques hold tremendous potential for further elucidating the conformational dynamics of Lgt during catalysis, providing deeper insights into this essential enzyme's mechanism. Time-resolved crystallography, which captures structural snapshots during different stages of the reaction, could reveal transient conformational states that are critical for substrate binding, catalysis, and product release . Cryo-electron microscopy (cryo-EM) offers the advantage of studying Lgt in a more native-like lipid environment, potentially capturing conformational flexibility that might be constrained in crystal structures. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) could map regions of Lgt that undergo dynamic changes upon substrate binding, providing insights into allosteric networks within the enzyme. Nuclear magnetic resonance (NMR) studies of specifically labeled Lgt domains could track local conformational changes during the catalytic cycle, particularly in the arm and head regions implicated in substrate specificity . Molecular dynamics simulations, informed by experimental structures, would allow in silico investigation of Lgt dynamics on timescales difficult to access experimentally, potentially revealing substrate approach pathways and conformational transitions. Single-molecule Förster resonance energy transfer (smFRET) experiments could monitor distance changes between strategically placed fluorophores during catalysis, providing direct observation of conformational states. Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling could measure distances between specific residues in different conformational states. Native mass spectrometry techniques might capture Lgt-substrate complexes in different states, providing insights into the progression of catalytic intermediates. These advanced approaches, particularly when used in combination, promise to transform our understanding of how Lgt's structure dynamically facilitates its essential catalytic function, potentially revealing new opportunities for inhibitor design .

What are the implications of understanding Lgt structure-function relationships for bacterial evolution and pathogenesis studies?

Understanding Lgt structure-function relationships has profound implications for bacterial evolution and pathogenesis studies, offering insights into fundamental aspects of bacterial adaptation and virulence mechanisms. The essential nature of Lgt in most Gram-negative bacteria suggests it represents an ancient and conserved component of bacterial physiology, making it a valuable lens through which to study evolutionary processes . Comparative analyses of Lgt across diverse bacterial species may reveal patterns of co-evolution with specific lipoprotein repertoires, potentially illuminating how bacteria have adapted their lipoprotein modification systems to different ecological niches . The observed structural differences in substrate-binding domains likely reflect evolutionary adaptations to species-specific lipoprotein requirements, providing insights into selective pressures acting on bacterial envelope systems . In pathogenesis studies, understanding how Lgt facilitates the processing of virulence-associated lipoproteins could reveal mechanistic links between lipoprotein modification and bacterial pathogenicity. The differences in Lgt substrate specificity between pathogenic species may contribute to host-pathogen interaction variations, potentially explaining species-specific virulence patterns . By mapping the evolutionary trajectory of Lgt across bacterial lineages, researchers might identify species-specific adaptations that could serve as targets for narrow-spectrum antimicrobials . Knowledge of Lgt structure-function relationships could inform genetic engineering approaches to modulate lipoprotein processing in both pathogenic and beneficial bacteria, with applications in vaccine development and probiotic engineering. The essentiality of Lgt in most Gram-negative bacteria but its dispensability in some Gram-positive species raises intriguing questions about the evolution of different cell envelope architectures and their relationship to bacterial lifestyle . Finally, understanding how bacteria maintain the critical function of Lgt while adapting its substrate specificity may provide broader insights into how essential enzymes evolve new specificities without compromising their core functions, a fundamental question in evolutionary biochemistry.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.