Recombinant Escherichia coli O8 Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; ECIAI1_0608; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGAFIIGMGFAWFSRMTN IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL FSASTAH
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration and its associated toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of the CrcB homolog protein in E. coli O8 strains?

The CrcB homolog in E. coli functions primarily as a fluoride ion channel/transporter, providing resistance to fluoride toxicity. In E. coli O8 strains, this protein maintains similar core functions as in other E. coli variants, though strain-specific modifications may exist. Research has shown that CrcB proteins form dimeric channels in the membrane that selectively transport fluoride ions out of the bacterial cell, thus preventing fluoride-mediated inhibition of essential enzymes. The protein is particularly important in maintaining bacterial viability in environments where fluoride concentrations might otherwise reach cytotoxic levels.

How does the genomic context of the crcB gene in E. coli O8 compare to other strains?

The genomic organization around the crcB gene can vary between different E. coli strains. In E. coli O8 strains, which have been associated with specific virulence factors like the heat-labile enterotoxin variant LT2d, the genomic context requires careful consideration when designing recombination experiments. Complete genome sequence determination, such as that performed for strain 16F5M1D1 using Oxford Nanopore MinION sequencer, revealed that the E. coli O8:H8 genome consisted of a 4,800,098-bp chromosome with 5 prophages and 2 tandemly integrated integrative elements . When studying crcB in this context, researchers should account for potential interactions with nearby genetic elements that might affect expression or function.

What expression systems are recommended for the production of recombinant CrcB protein from E. coli O8?

For recombinant CrcB protein production from E. coli O8, researchers should consider several expression systems based on research requirements:

  • T7 RNA polymerase-based systems (pET vectors) - Provide high-yield expression under IPTG induction

  • Arabinose-inducible systems (pBAD vectors) - Allow for more tightly regulated expression

  • Constitutive expression systems - Useful for stable, continuous production

The choice depends on whether membrane protein overexpression toxicity is observed. When using RecA-deficient strains for stable plasmid maintenance, consider that RarA protein makes a major enzymatic contribution to RecA-independent recombination, which could affect plasmid stability over multiple generations . Strains with both ΔrarA and ΔrecA modifications may provide improved stability for difficult-to-clone recombinant constructs.

What are the key considerations for designing primers for cloning the crcB homolog from E. coli O8?

When designing primers for cloning the crcB homolog from E. coli O8, researchers should consider:

  • Sequence specificity - Ensure primers are specific to the crcB variant in O8 strains

  • Restriction site inclusion - Add appropriate restriction sites for downstream cloning, avoiding sites present in the target gene

  • Codon optimization - Consider adding optimized codons if expressing in a heterologous system

  • Expression tag compatibility - Include sequences for N- or C-terminal tags as needed

For in vivo cloning applications, include at least 20 bp of homology to the target vector at primer termini. Recent research indicates that while RecET recombinase was initially identified as important for in vivo cloning, it is not strictly required; exonuclease XthA plays a key role, and RarA protein contributes to RecA-independent recombination efficiency. A deletion of rarA reduced in vivo cloning efficiency by 20%-60% relative to wild-type strains .

How should researchers troubleshoot low yield of recombinant CrcB protein in E. coli expression systems?

When troubleshooting low yield of recombinant CrcB protein, implement a systematic approach:

  • Transcriptional optimization:

    • Verify promoter strength and inducibility

    • Check for regulatory elements affecting expression

    • Confirm correct reading frame and absence of premature stop codons

  • Translational optimization:

    • Evaluate codon usage and optimize if necessary

    • Assess ribosome binding site efficiency

    • Consider using strains with rare tRNA supplements

  • Protein stability factors:

    • Test different growth temperatures (16°C, 25°C, 37°C)

    • Evaluate induction duration and inducer concentration

    • Add protease inhibitors during purification

  • Membrane protein-specific considerations:

    • Use specialized E. coli strains (C41, C43) developed for membrane protein expression

    • Consider fusion partners that enhance membrane insertion

    • Evaluate different detergents for solubilization

For membrane proteins like CrcB, toxicity may result from overexpression. Consider using tightly regulated expression systems with careful titration of inducer concentration.

What purification strategy works best for maintaining the structural integrity of CrcB homolog protein?

For maintaining structural integrity during purification of the CrcB homolog protein:

Recommended purification protocol:

  • Cell lysis and membrane preparation:

    • Use gentle cell disruption methods (e.g., French press or sonication with cooling)

    • Isolate membrane fractions via differential centrifugation

    • Wash membranes to remove peripheral proteins

  • Solubilization:

    • Screen detergents (DDM, LMNG, CHAPS) at concentrations just above CMC

    • Include stabilizing agents (glycerol 10%, specific lipids)

    • Maintain buffer pH between 7.0-8.0 with appropriate ionic strength

  • Affinity chromatography:

    • Use immobilized metal affinity chromatography (IMAC) for His-tagged constructs

    • Apply longer binding times than soluble proteins (2-3 hours)

    • Include detergent in all buffers at concentrations above CMC but below disruptive levels

  • Additional purification steps:

    • Size exclusion chromatography to ensure homogeneity

    • Concentrate samples using high molecular weight cutoff concentrators

    • Perform quality control using analytical SEC and/or native PAGE

Throughout purification, maintain temperature at 4°C and include protease inhibitors to prevent degradation. Consider adding stabilizing lipids if functional studies are planned.

How can researchers effectively study the structure-function relationship of the CrcB homolog using site-directed mutagenesis?

To effectively study structure-function relationships of CrcB homolog using site-directed mutagenesis:

For E. coli O8 CrcB variants, compare results with known CrcB structures to identify strain-specific functional adaptations.

What are the challenges in differentiating native versus recombinant CrcB function in E. coli O8 studies?

Differentiating native versus recombinant CrcB function presents several challenges:

  • Background interference:

    • Endogenous CrcB can mask recombinant protein effects

    • Solutions: Use crcB knockout strains or CRISPR interference to suppress native expression

  • Expression level artifacts:

    • Overexpression can lead to non-physiological effects

    • Solutions: Develop tunable expression systems or replace chromosomal gene with tagged version

  • Functional redundancy:

    • Multiple fluoride exporters may exist in E. coli

    • Solutions: Construct multiple knockout strains to eliminate redundant systems

  • Strain-specific variations:

    • E. coli O8 may have unique regulatory networks affecting CrcB function

    • Solutions: Compare with well-characterized E. coli strains like MG1655

A rigorous approach would involve generating precise chromosomal replacements of the native crcB with epitope-tagged or mutant versions, maintaining the natural promoter and regulatory context.

How can researchers effectively characterize the oligomeric state of the CrcB homolog in membrane environments?

To characterize the oligomeric state of CrcB homolog in membrane environments:

In vitro approaches:

  • Crosslinking strategies:

    • Use membrane-permeable crosslinkers at varying concentrations

    • Analyze products via SDS-PAGE and western blotting

    • MS/MS analysis of crosslinked products for interface mapping

  • Biophysical techniques:

    • Blue native PAGE for intact membrane protein complexes

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation with detergent-solubilized protein

In vivo approaches:

  • FRET-based methods:

    • Create CrcB fusions with fluorescent protein pairs

    • Measure energy transfer efficiencies in live cells

    • Calculate distances between subunits

  • Split-protein complementation:

    • Split fluorescent proteins or enzymatic reporters

    • Co-express fusion constructs and measure reconstituted activity

    • Titrate expression levels to determine stoichiometry

TechniqueAdvantagesLimitationsSample Requirements
CrosslinkingWorks in native membranesPotential artifactsIntact cells or isolated membranes
Blue Native PAGEPreserves native complexesDetergent sensitivityPurified membranes
SEC-MALSAbsolute molecular weightRequires solubilizationPurified protein (1-5 mg)
FRETIn vivo measurementFluorophore interferenceLive cells expressing fusions
ComplementationFunctional readoutPotential steric effectsLive cells expressing split constructs

How should researchers interpret contradictory results between in vitro and in vivo studies of CrcB homolog function?

When encountering contradictory results between in vitro and in vivo studies of CrcB homolog function:

  • Systematic evaluation:

    • Compare experimental conditions (pH, ionic strength, temperature)

    • Assess protein modifications (tags, truncations) that might affect function

    • Evaluate the lipid environment differences between systems

  • Reconciliation approaches:

    • Develop intermediate systems (spheroplasts, membrane vesicles)

    • Reconstitute purified protein in native lipid extracts

    • Perform complementation studies in knockout strains

  • Technical considerations:

    • Detergent effects on protein conformation and activity

    • Expression level differences affecting oligomerization

    • Presence of interacting partners in vivo absent in vitro

Remember that membrane proteins like CrcB often require specific lipid environments and may interact with other cellular components that aren't present in simplified in vitro systems. The native genomic context in E. coli O8 strains, which contain various prophages and integrated elements as observed in strain 16F5M1D1 , may provide additional regulatory factors affecting CrcB expression or function.

What statistical approaches are most appropriate for analyzing fluoride transport activity data of recombinant CrcB proteins?

For analyzing fluoride transport activity data of recombinant CrcB proteins:

  • For concentration-dependent transport studies:

    • Michaelis-Menten kinetics analysis (Km, Vmax determination)

    • Non-linear regression for cooperative binding (Hill coefficient)

    • Analysis of variance (ANOVA) for comparing multiple variants

  • For time-course experiments:

    • Initial rate measurements with linear regression

    • Exponential decay fitting for efflux studies

    • Area under curve (AUC) calculations for total transport capacity

  • For comparing CrcB variants:

    • Paired t-tests for direct comparisons of two variants

    • Multiple comparison corrections (Bonferroni, Tukey HSD) when testing several mutants

    • Two-way ANOVA for evaluating effects of mutations and conditions simultaneously

Sample data table for transport activity analysis:

CrcB VariantInitial Rate (nmol/min/mg)Km (μM)Vmax (nmol/min/mg)Hill Coefficientp-value vs. WT
Wild-type245 ± 18127 ± 12312 ± 241.03 ± 0.08-
R45A78 ± 11230 ± 25135 ± 180.94 ± 0.11<0.001
D67N212 ± 22410 ± 38285 ± 271.12 ± 0.090.042
E103Q32 ± 7175 ± 2648 ± 111.67 ± 0.21<0.001

Include appropriate biological replicates (n≥3) and technical replicates (n≥3) for robust statistical analysis. Report standard deviation or standard error consistently.

How does the CrcB homolog in E. coli O8 relate to virulence factors and potential therapeutic targets?

The relationship between CrcB homolog and virulence in E. coli O8:

While CrcB itself is primarily involved in fluoride resistance rather than direct virulence, understanding its function in pathogenic E. coli O8 strains provides context for bacterial survival mechanisms. E. coli O8:H8 strains have been identified in diarrheal outbreaks carrying specific virulence factors such as the heat-labile enterotoxin LT2d and colonization factor antigen III (CFA/III) .

These pathogenic E. coli O8:H8 strains contain a prophage-encoded gene for a novel variant of heat-labile enterotoxin (LT2d) and genes for colonization factors on a large plasmid . While CrcB is not directly implicated in this pathogenic mechanism, fluoride channels could potentially influence bacterial persistence under stress conditions.

For therapeutic development:

  • CrcB inhibitors could potentially sensitize bacteria to fluoride-containing treatments

  • Understanding membrane protein expression in E. coli O8 contributes to developing strategies for targeting other membrane-associated virulence factors

  • Fluoride transporters represent potential targets for synergistic antimicrobial approaches

Research should focus on determining if CrcB expression is altered during infection or under conditions mimicking the host environment.

What are the current methodological limitations in studying CrcB homolog interactions with other membrane proteins?

Current methodological limitations in studying CrcB interactions include:

  • Technical challenges:

    • Difficulty maintaining native membrane environments

    • Limited resolution of in vivo imaging techniques

    • Potential artifacts from overexpression or tagging

  • Experimental approaches and limitations:

    • Co-immunoprecipitation requires effective solubilization without disrupting interactions

    • FRET-based methods may be limited by fluorophore size and orientation

    • Proximity labeling techniques (BioID, APEX) can identify neighbors but not direct interactions

    • Genetic interaction screens may miss redundant functions

  • Emerging solutions:

    • Advanced membrane mimetics (nanodiscs, SMALPs)

    • Cryo-electron microscopy for structural studies of membrane protein complexes

    • In-cell NMR for studying dynamics in native environments

    • Genetic approaches using RecA-independent recombination for subtle genomic modifications

When working with RecA-deficient strains to maintain plasmid stability, consider that studies have demonstrated RarA makes a significant contribution to RecA-independent recombination, particularly for intermolecular recombination events involving short homologies . This property can be leveraged for generating subtle mutations in membrane protein genes.

How can researchers effectively integrate structural studies with functional analyses of CrcB homologs across E. coli strains?

To effectively integrate structural and functional studies of CrcB homologs:

  • Systematic approach:

    • Sequence alignment of CrcB across diverse E. coli strains, including O8

    • Identification of strain-specific variations in conserved domains

    • Structural modeling based on available crystal structures

    • Targeted mutagenesis of variant residues

  • Functional characterization pipeline:

    • Standardized fluoride sensitivity assays across strain backgrounds

    • Protein expression and localization studies using consistent methods

    • Ion transport measurements under defined conditions

    • Complementation studies in crcB-knockout backgrounds

  • Integrative analysis framework:

Structural ElementSequence ConservationFunctional ImpactStrain-Specific Variations
Transmembrane domain 1High (>90%)Ion selectivityE. coli O8: F23L substitution
Pore-lining residuesModerate (70-85%)Transport rateE. coli O8: conserved
Cytoplasmic loopLow (<50%)Regulatory interactionsE. coli O8: 3aa insertion
Oligomerization interfaceHigh (>95%)Assembly/stabilityE. coli O8: conserved
  • Key methodologies:

    • Cryogenic electron microscopy for structural determination

    • Site-directed mutagenesis for structure-function validation

    • Electrophysiology for direct functional measurements

    • Molecular dynamics simulations to predict effects of variations

When manipulating E. coli O8 genomes, researchers should consider the strain's genomic features, including prophages and integrated elements that might affect recombination efficiency . Additionally, for in vivo cloning approaches, the contribution of RarA to RecA-independent recombination should be considered, as loss of RarA activity can reduce cloning efficiency by 20-60% .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.