Recombinant Escherichia coli O8 Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Rhomboid proteases are conserved intramembrane serine proteases that cleave transmembrane substrates, playing roles in bacterial signaling and pathogenesis . E. coli GlpG is a six-transmembrane domain protein with a catalytic Ser-His dyad, critical for proteolytic activity . The recombinant O8 strain variant (UniProt ID: B7M2I4) retains these features and is produced for experimental applications .

Proteolytic Activity

  • Substrate Recognition: Cleaves model substrates (e.g., LacY-derived transmembrane proteins) between Ser and Asp residues in hydrophilic juxtamembrane regions .

  • Catalytic Residues: Ser and His residues are essential for activity; mutations (e.g., S201A) abolish proteolysis .

  • Inhibitor Sensitivity: Covalently binds fluorophosphonate probes (e.g., IC 36) and is inhibited by β-lactams .

Biological Roles

  • Gut Colonization: GlpG promotes E. coli persistence in the mammalian gut by regulating glycerol degradation and fatty acid β-oxidation pathways .

  • Membrane Remodeling: Modifies lipid bilayer thickness to enhance substrate accessibility .

Research Applications

Recombinant GlpG is utilized in:

  • Mechanistic Studies: Activity-based protein profiling (ABPP) with fluorophosphonates to map catalytic integrity .

  • Structural Biology: Crystallography (e.g., PDB: 2IC8) and NMR to resolve substrate-binding conformations .

  • Pathogenesis Models: Investigating gut colonization dynamics of extraintestinal pathogenic E. coli (ExPEC) .

Recent Advances

  • Membrane Dynamics: GlpG-induced membrane thinning is critical for substrate cleavage, independent of lipid headgroups .

  • Exosite Discovery: Cytoplasmic residues (e.g., Arg227) and N-terminal regions enhance catalytic efficiency .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
glpG; ECIAI1_3567; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVVMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK
Uniprot No.

Target Background

Function
Rhomboid-type serine protease catalyzes intramembrane proteolysis.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rhomboid protease glpG and what is its functional significance in E. coli?

Rhomboid protease glpG (EC 3.4.21.105) is an intramembrane serine protease belonging to the rhomboid family of proteases that cleave substrate proteins within their transmembrane domains. In E. coli, glpG is directly or indirectly associated with fatty acid beta-oxidation pathways and plays a crucial role in glycerol metabolism regulation . Research has demonstrated that glpG contributes significantly to ExPEC (Extraintestinal pathogenic Escherichia coli) fitness in mucus broth, which models the intestinal environment .

The biological significance of glpG extends beyond basic metabolism. The disruption of glpG has been shown to significantly reduce ExPEC survival in the mouse gut, with competitive index dropping to -2.08 by day 14, representing more than a 120-fold reduction in mutant bacterial numbers compared to wild-type titers . This indicates glpG's important role in bacterial persistence within the mammalian gastrointestinal tract.

What are the optimal storage and handling conditions for recombinant glpG protein?

For optimal stability and activity, recombinant glpG protein should be stored at -20°C, and for extended storage, conserved at -20°C or -80°C. Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity. For short-term use, working aliquots can be stored at 4°C for up to one week .

The shelf life of recombinant glpG varies depending on its formulation: the liquid form is generally stable for approximately 6 months at -20°C/-80°C, while the lyophilized form can maintain stability for up to 12 months at -20°C/-80°C . These parameters may vary based on buffer composition and protein concentration, so it's advisable to verify stability with specific product documentation.

How should I design experiments to investigate the role of glpG in bacterial fitness?

Based on established research methodologies, an effective experimental design to study glpG function should include multiple approaches:

Strain Construction and Validation:

  • Generate precise gene deletions (ΔglpG, ΔglpEGR) using lambda Red recombination or CRISPR-Cas9

  • Create complementation strains expressing glpG, glpEG, or glpEGR from plasmids

  • Verify deletions and complementation by PCR and sequencing

  • Confirm protein expression levels in complementation strains by Western blot

Phenotypic Characterization:
Implement growth studies in multiple media conditions to assess the impact of glpG on bacterial fitness:

Experiment TypeStrains to CompareMedia/ConditionsMeasurementsControls
Growth CurveWT, ΔglpG, ΔglpEGRStandard LB brothOD600 every hour for 24hMedia only
Growth CurveWT, ΔglpG, ΔglpEGRIntestinal mucus brothOD600 every hour for 24hMedia only
Plate GrowthWT, ΔglpG, ΔglpEGRMinimal media + glucoseColony formation after 24-48hMedia only
Plate GrowthWT, ΔglpG, ΔglpEGRMinimal media + oleateColony formation after 24-48hMedia only
Competition AssayWT vs ΔglpG (1:1)Mucus brothCompetitive index at 24hInitial ratio
In vivo CompetitionWT vs ΔglpG (1:1)Mouse intestineCompetitive index at days 1, 7, 14Initial ratio

This comprehensive approach allows for robust assessment of glpG's role under various conditions relevant to its biological function .

What expression systems are most effective for producing recombinant glpG?

For successful recombinant glpG production, in vitro E. coli expression systems have been proven effective, though several considerations must be addressed given glpG's nature as a transmembrane protein :

Vector and Promoter Selection:

  • Use vectors with tightly controlled promoters (T7, araBAD) to prevent toxicity

  • Consider low-copy vectors to reduce metabolic burden

  • Include fusion tags (His, GST, MBP) to facilitate purification and potentially enhance solubility

Host Strain Optimization:
E. coli strains designed for membrane protein expression offer advantages:

  • C41(DE3) and C43(DE3) derived from BL21(DE3) with adaptations for membrane protein expression

  • Lemo21(DE3) allowing tunable expression through T7 lysozyme levels

  • SHuffle strains for proteins requiring disulfide bonds

Expression Conditions:

  • Lower temperatures (16-25°C) to slow folding and prevent aggregation

  • Reduced inducer concentrations to prevent overwhelming the membrane insertion machinery

  • Extended expression times (24-48 hours) to maximize yield

  • Consider specialized media formulations with glycerol supplementation

Research indicates that for transmembrane proteins like glpG, optimizing the expression system is critical for obtaining correctly folded, functional protein .

How can I establish a reliable data table system for tracking glpG mutation effects?

Establishing a standardized data collection and analysis system is crucial for tracking the effects of glpG mutations across different experimental conditions. Following established scientific data table guidelines 3, researchers should:

  • Identify variables clearly:

    • Independent variable: Strain genotype (WT, ΔglpG, ΔglpEGR, complemented strains)

    • Dependent variables: Growth rates, competitive indices, enzyme activities

    • Controlled variables: Media composition, temperature, oxygen levels

  • Design comprehensive tables with proper labeling:

    • Include descriptive title indicating the relationship being examined

    • Label columns with variables and their units

    • Include multiple trials for statistical validity

    • Calculate derived values (means, standard deviations, competitive indices)

Example Data Table for Competition Assay Results:

Time PointTrialWild-type CFU/mlΔglpG CFU/mlRatio (ΔglpG/WT)Competitive Index (CI)
Input (0h)15.2 × 10^65.0 × 10^60.96-
Input (0h)24.8 × 10^64.9 × 10^61.02-
Input (0h)35.1 × 10^65.2 × 10^61.02-
24h Mucus12.1 × 10^88.2 × 10^70.39-0.41
24h Mucus21.9 × 10^87.8 × 10^70.41-0.39
24h Mucus32.2 × 10^89.0 × 10^70.41-0.39
Mean---0.40 ± 0.01-0.40 ± 0.01

This methodical approach ensures reproducibility and facilitates meaningful comparisons between independent experiments .

What methodologies can be employed to identify potential substrates of glpG protease?

Identifying substrates of intramembrane proteases like glpG presents unique challenges that require specialized approaches:

Comparative Proteomics:

  • Conduct quantitative membrane proteomics comparing wild-type and ΔglpG strains

  • Use SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tag) labeling for precise quantification

  • Look for proteins that accumulate in the ΔglpG strain, indicating potential substrates

  • Validate candidates with targeted assays such as Western blotting

Candidate-Based Approaches:

  • Generate a library of potential transmembrane domain substrates based on:

    • Proteins involved in glycerol metabolism

    • Proteins affecting bacterial fitness in mucus environments

    • Known substrates of other rhomboid proteases

  • Express tagged versions of these candidates in wild-type and ΔglpG backgrounds

  • Monitor processing by immunoblotting or mass spectrometry

Genetic Screening:
Employ suppressor screens to identify genes that can compensate for glpG deletion:

  • Mutagenize ΔglpG strain and select for restored growth in restrictive conditions

  • Sequence suppressors to identify potential pathway components

  • Create double mutants to confirm genetic interactions

In vitro Cleavage Assays:

  • Reconstitute purified glpG in liposomes or detergent micelles

  • Incubate with candidate substrates

  • Analyze cleavage products using SDS-PAGE, HPLC, or mass spectrometry

These approaches have proven successful in identifying substrates for other bacterial proteases and can be adapted specifically for glpG research .

How can we analyze the relationship between glpG and glycerol degradation pathways?

Studies have demonstrated that disruption of glpG has polar effects on the downstream gene glpR, which encodes a transcriptional repressor of factors that catalyze glycerol degradation . Investigating this relationship requires a multi-faceted approach:

Transcriptional Analysis:

  • Perform RNA-seq or qPCR to measure expression of genes in the glycerol degradation pathway in:

    • Wild-type E. coli

    • ΔglpG mutant

    • ΔglpR mutant

    • ΔglpG ΔglpR double mutant

  • Include genes such as glpF (glycerol facilitator), glpK (glycerol kinase), and glpD (glycerol-3-phosphate dehydrogenase)

Metabolic Profiling:

  • Use liquid chromatography-mass spectrometry (LC-MS) to measure:

    • Intracellular glycerol and glycerol-3-phosphate levels

    • Intermediates of glycerol metabolism

    • Related metabolic pathways including fatty acid metabolism

  • Compare metabolite profiles across different carbon sources (glucose vs. glycerol vs. oleate)

Protein-Protein Interaction Studies:

  • Employ bacterial two-hybrid or pull-down assays to identify interactions between:

    • glpG and components of glycerol metabolism

    • glpG and potential regulatory proteins

  • Confirm interactions using techniques like biolayer interferometry or surface plasmon resonance

Growth Phenotype Characterization:
Compare growth of WT and mutant strains on different carbon sources:

StrainGlucose GrowthGlycerol GrowthOleate GrowthG3P Growth
Wild-type++++++++++++
ΔglpG+++++++
ΔglpR+++++++++++++++
ΔglpG ΔglpR++++++++++++++
ΔglpG + pglpG++++++++++++
ΔglpG + pglpEGR++++++++++++

This systematic analysis can elucidate the regulatory connections between glpG and glycerol metabolism .

How does recombinant glpG compare structurally and functionally to other rhomboid proteases?

Rhomboid proteases are widely distributed across bacteria, and comparative analysis provides valuable insights into evolutionary adaptations and functional conservation:

Structural Comparison:

  • Align sequences of bacterial rhomboid proteases to identify:

    • Conserved catalytic residues (typically serine and histidine)

    • Variable loops that may confer substrate specificity

    • Transmembrane topology differences

  • Compare available crystal structures of rhomboid proteases:

    • GlpG from E. coli has been crystallized and serves as a structural model

    • Comparing with other rhomboids reveals conservation of the catalytic mechanism but differences in substrate binding pockets

Functional Complementation:

  • Express rhomboid proteases from different bacterial species in E. coli ΔglpG strains

  • Assess restoration of phenotypes:

    • Growth in mucus

    • Oleate utilization

    • In vivo colonization capacity

  • Create chimeric proteins swapping domains between different rhomboids to map functional regions

Evolutionary Analysis:

  • Construct phylogenetic trees of rhomboid proteases across bacterial species

  • Correlate rhomboid features with bacterial lifestyles:

    • Host-associated vs. free-living bacteria

    • Metabolic capabilities

    • Niche adaptations

Substrate Specificity:

  • Test cleavage of model substrates by different rhomboid proteases

  • Identify sequence motifs or structural features recognized by specific rhomboids

  • Use this information to predict natural substrates in different bacterial species

This comparative approach helps place glpG in an evolutionary context and may reveal specialized functions that have evolved in different bacterial lineages .

How can I address common challenges in recombinant glpG expression and purification?

As a multi-spanning transmembrane protein, glpG presents several challenges during recombinant expression and purification. Here are methodological solutions to common issues:

Low Expression Yields:

  • Optimize codon usage for the host organism using algorithms like the Codon Adaptation Index

  • Test different promoter strengths and induction conditions

  • Consider fusion partners known to enhance membrane protein expression (MBP, Mistic)

  • Incorporate rare tRNA-expressing plasmids when using non-optimized coding sequences

Protein Misfolding and Aggregation:

  • Lower expression temperature to 16-20°C to slow folding kinetics

  • Use specialized E. coli strains with altered membrane composition

  • Add specific lipids to the growth medium that stabilize membrane proteins

  • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

Purification Challenges:

  • Screen multiple detergents for optimal solubilization:

    • Mild detergents (DDM, LMNG) often work well for membrane proteins

    • Detergent concentration should be optimized (typically 1-2% for extraction, 2-3× CMC for purification)

  • Implement two-step purification:

    • Initial IMAC (Immobilized Metal Affinity Chromatography) using the His-tag

    • Secondary purification by size exclusion or ion exchange chromatography

  • Consider stabilizing additives:

    • Glycerol (10-20%)

    • Specific lipids (E. coli total lipid extract)

    • Protease inhibitors

Activity Loss During Purification:

  • Verify protein folding using circular dichroism spectroscopy

  • Test activity immediately after each purification step

  • Reconstitute purified protein in liposomes to restore native-like environment

  • Use fluorogenic substrates for sensitive activity detection

These approaches have been successfully applied to other membrane proteins and can be adapted for glpG research .

How can I resolve contradictory data in glpG functional studies?

When faced with contradictory results in glpG research, a systematic approach to data analysis and experimental design can help resolve discrepancies:

Source Analysis:

  • Document precise experimental conditions for all experiments:

    • E. coli strain background (lab strains vs. clinical isolates)

    • Growth conditions (media, temperature, aeration)

    • Mutation construction method (clean deletion vs. insertion)

  • Apply CONTRADOC methodology to systematically analyze potential self-contradictions

Validation Strategies:

  • Employ multiple independent methods to test the same hypothesis

  • Use complementation studies to confirm phenotype specificity:

    • Test with wild-type glpG

    • Test with catalytically inactive glpG (serine to alanine mutation)

    • Test with different promoter strengths to assess dose-dependence

  • Generate independent mutants using different approaches

Experimental Variable Control:
Create a structured matrix of experimental conditions to identify context-dependent effects:

VariableCondition 1Condition 2Condition 3
MediaLBMinimal + glucoseMinimal + oleate
Growth phaseEarly logMid logStationary
Oxygen levelAerobicMicroaerobicAnaerobic
Temperature25°C37°C42°C
Strain backgroundK-12B strainClinical isolate

Test critical phenotypes across this matrix to identify conditions where contradictions arise or resolve.

Statistical Approach:

  • Increase biological replicates (n ≥ 5) to strengthen statistical power

  • Apply appropriate statistical tests based on data distribution

  • Perform meta-analysis if multiple datasets are available

  • Consider Bayesian approaches to incorporate prior knowledge

This methodical troubleshooting approach can identify experimental variables responsible for contradictory results and lead to a more nuanced understanding of glpG function .

What are the best methods for analyzing competition assay data between wild-type and glpG mutant strains?

Competition assays provide sensitive measures of relative fitness differences between bacterial strains. For glpG research, proper data analysis is crucial for accurate interpretation:

Data Collection Protocol:

  • Mix wild-type and mutant strains at 1:1 ratio (verify by plating)

  • Grow in the condition of interest (mucus broth, mouse intestine, etc.)

  • Plate on selective and non-selective media at designated time points

  • Calculate CFU/ml for each strain

Competitive Index Calculation:
The competitive index (CI) is calculated as:
CI = log10[(mutant/wild-type)output/(mutant/wild-type)input]

A negative CI indicates the mutant is less fit than wild-type. For example, a CI of -2.0 represents a 100-fold reduction in relative fitness.

Statistical Analysis:

  • Perform experiments with at least 3-5 biological replicates

  • Apply non-parametric tests (Mann-Whitney) for small sample sizes

  • Use ANOVAs with post-hoc tests when comparing multiple conditions

  • Report confidence intervals alongside p-values

Visualization Techniques:

  • Plot CI values over time to track fitness dynamics

  • Use box plots or violin plots to show distribution of CI values

  • Consider log-scale plots for absolute CFU values to visualize population changes

Control Considerations:

  • Include competitions between differentially marked wild-type strains to ensure markers are neutral

  • For in vivo experiments, confirm similar intestinal transit times for both strains

  • Verify that selective plating accurately distinguishes strains

This approach has successfully demonstrated the significant fitness defect of ΔglpG mutants, with CI dropping to -2.08 by day 14 in mouse gut colonization experiments, representing more than a 120-fold reduction compared to wild-type bacteria .

How might glpG be exploited as a target for antimicrobial development?

Given glpG's importance for ExPEC fitness in the mammalian gut , it represents a promising target for novel antimicrobial strategies:

Inhibitor Development:

  • Structure-based drug design targeting the active site of glpG:

    • Identify compounds that bind the catalytic serine

    • Design transition-state analogs of peptide bond hydrolysis

    • Optimize compounds for membrane penetration

  • High-throughput screening approaches:

    • Develop fluorogenic substrates for activity-based screens

    • Implement bacterial growth assays in conditions requiring glpG

    • Screen natural product libraries for selective inhibitors

Targeting Downstream Pathways:

  • Identify metabolic vulnerabilities in ΔglpG strains:

    • Compounds that further impair glycerol or fatty acid metabolism

    • Inhibitors of alternative pathways that become essential in ΔglpG backgrounds

  • Develop combination therapies targeting multiple components of the glycerol utilization pathway

Colonization Resistance Strategies:

  • Engineer probiotic strains to:

    • Outcompete ExPEC for intestinal niches

    • Produce compounds that selectively inhibit glpG-dependent processes

    • Enhance host defenses against ExPEC colonization

Vaccine Development:

  • Evaluate attenuated ΔglpG strains as live vaccine candidates:

    • Assess immunogenicity and protective efficacy

    • Determine correlates of protection

    • Test cross-protection against diverse ExPEC strains

The decreased persistence of glpG mutants in the mammalian gut provides a strong rationale for these approaches to combat ExPEC infections by targeting colonization rather than growth .

What novel experimental approaches could advance our understanding of glpG's role in bacterial physiology?

Several cutting-edge techniques could significantly enhance our understanding of glpG's function:

Single-Cell Analysis:

  • Implement microfluidic devices to track individual bacterial cells:

    • Monitor growth rates and division patterns of wild-type vs. ΔglpG

    • Assess cell-to-cell variability in gene expression

    • Identify subpopulations with distinct phenotypes

  • Use single-cell RNA-seq to profile transcriptional differences

Cryo-Electron Tomography:

  • Visualize membrane organization and protein complexes in native state

  • Compare wild-type and ΔglpG strains to identify structural differences

  • Localize glpG within the bacterial membrane using gold-labeled antibodies

CRISPR Interference/Activation:

  • Employ CRISPRi to create tunable knockdowns of glpG

  • Use CRISPRa to upregulate glpG expression

  • Create genome-wide screens for genetic interactions with glpG

Metabolic Flux Analysis:

  • Use 13C-labeled substrates to track carbon flow through metabolic pathways

  • Compare flux distributions between wild-type and ΔglpG strains

  • Identify metabolic bottlenecks and compensatory pathways

Host-Microbe Interaction Studies:

  • Implement organoid models to study ExPEC interaction with intestinal epithelium

  • Use gnotobiotic mice with defined microbiota to assess the role of glpG in community context

  • Develop dual RNA-seq approaches to simultaneously profile host and bacterial responses

PhaNGS Technique Application:
Adapting the Phage-based Next Generation Sequencing (PhaNGS) technique could enable:

  • Identification of membrane proteins interacting with glpG

  • Screening for substrates using phage-displayed transmembrane domains

  • Mapping the binding site specificity through mutational scanning

These advanced approaches would provide mechanistic insights into glpG function beyond what can be achieved with traditional techniques .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.