Recombinant Escherichia coli O8 Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted according to customer needs.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdtI; ECIAI1_1649; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
mdtI
Target Protein Sequence
MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA
Uniprot No.

Target Background

Function

Function: Catalyzes the excretion of spermidine.

Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MdtI protein and what is its primary function in Escherichia coli?

MdtI is a spermidine export protein in Escherichia coli that belongs to the small multidrug resistance (SMR) family of drug exporters. It functions as part of a protein complex with MdtJ (MdtJI complex) to catalyze the excretion of spermidine from bacterial cells . This function is particularly important for cell survival when spermidine overaccumulates within the cell, as excessive intracellular spermidine levels can become toxic. Experimental evidence has demonstrated that both mdtJ and mdtI genes are necessary for recovery from spermidine toxicity . The protein is encoded by the mdtI gene (also identified as ECIAI1_1649 in E. coli O8 strain IAI1) and plays a critical role in polyamine homeostasis, which is essential for normal cell growth and function .

How can researchers verify the spermidine export function of recombinant MdtI in experimental systems?

Researchers can verify the spermidine export function through several complementary approaches:

Cell Viability Assays:

  • Transform an E. coli strain deficient in spermidine acetyltransferase (such as E. coli CAG2242) with plasmids expressing mdtJI genes

  • Culture cells with and without high concentrations of spermidine (e.g., 2 mM and 12 mM)

  • Compare cell viability and growth between transformed cells and controls

Polyamine Content Analysis:

  • Measure intracellular spermidine levels in cells grown in the presence of exogenous spermidine

  • Compare spermidine accumulation in cells expressing MdtJI versus control cells

  • Observe reduced intracellular accumulation in MdtJI-expressing cells

Direct Measurement of Spermidine Excretion:

  • Load cells with radiolabeled [14C]spermidine

  • Monitor excretion of radioactive spermidine into the external medium over time

  • Confirm spermidine identity in the reaction mixture after removing cells by centrifugation

Research has shown that expression of mdtJI genes in E. coli CAG2242 increased cell viability >1,000-fold when cultured with 2 mM spermidine and rescued cell growth in the presence of 12 mM spermidine .

What are the structural characteristics of the MdtI protein?

MdtI is a small membrane protein with the following structural characteristics:

Key Features:

  • Full-length protein consists of 109 amino acids

  • Contains multiple transmembrane domains characteristic of membrane transporters

  • Belongs to the SMR (Small Multidrug Resistance) family of transporters

  • Forms a functional complex with MdtJ protein

  • Contains several critical residues essential for function including Glu5, Glu19, Asp60, Trp68, and Trp81

Functional Elements:

  • Hydrophobic transmembrane segments that anchor the protein in the cell membrane

  • Charged residues that likely participate in substrate recognition and transport

  • Aromatic residues (tryptophan) that may be involved in substrate binding or protein-protein interactions

The protein operates in conjunction with MdtJ to form a heterodimeric complex required for spermidine export activity.

How is the expression of mdtI regulated in Escherichia coli?

The expression of mdtI in E. coli is regulated through several mechanisms:

Substrate Induction:

  • The level of mdtJI mRNA is increased by the presence of spermidine, suggesting a substrate-induced expression mechanism

  • This represents a feedback response system where the export machinery is upregulated when the substrate concentration increases

Coordinate Expression:

  • The mdtJ and mdtI genes are typically co-expressed, as both are required for functional spermidine export

  • They likely form an operon structure within the E. coli genome

Environmental Stress Responses:

  • Expression may be linked to cellular stress responses, particularly those involving polyamine homeostasis

  • The expression patterns may differ between various growth conditions (rich versus minimal media)

Genetic Context:

  • The mdtI gene may be part of larger regulatory networks involving cell envelope biosynthesis and maintenance

  • Genetic interaction mapping studies have revealed functional dependencies and associations with other cellular systems

Understanding these regulatory mechanisms is crucial for manipulating MdtI expression in experimental systems and for interpreting its physiological role in different environmental conditions.

What are the key amino acid residues in MdtI essential for spermidine export, and how can they be studied through site-directed mutagenesis?

Research has identified several key amino acid residues in MdtI that are critical for its spermidine export function. These include Glu5, Glu19, Asp60, Trp68, and Trp81 . To study these residues through site-directed mutagenesis, researchers can employ the following methodological approach:

Site-Directed Mutagenesis Protocol:

  • Design primers to introduce specific mutations at codons encoding target residues

  • Perform PCR-based mutagenesis using a plasmid containing the wild-type mdtI gene

  • Transform E. coli with mutant constructs

  • Verify mutations through DNA sequencing

Functional Analysis of Mutants:

  • Express mutant proteins in a strain deficient in spermidine acetyltransferase (e.g., E. coli CAG2242)

  • Challenge cells with toxic levels of spermidine (2-12 mM)

  • Assess cell viability, growth curves, and spermidine accumulation

  • Measure direct spermidine export using radiolabeled [14C]spermidine

Structural Analysis:

  • Express and purify recombinant wild-type and mutant MdtI proteins

  • Perform circular dichroism spectroscopy to assess effects on secondary structure

  • Use fluorescence spectroscopy to examine tryptophan environments and potential substrate binding

Potential Residue Functions:

  • Acidic residues (Glu5, Glu19, Asp60): Likely involved in substrate recognition, binding, or proton coupling

  • Aromatic residues (Trp68, Trp81): May participate in substrate binding pocket formation or stabilize protein-protein interactions with MdtJ

This systematic mutagenesis approach can provide insights into the molecular mechanism of spermidine export and the structure-function relationship of the MdtJI complex.

How can genetic interaction mapping be used to identify functional associations between MdtI and other components of the E. coli cell envelope?

Genetic interaction mapping offers a powerful approach to understanding the functional relationships between MdtI and other components of the E. coli cell envelope. The methodology involves:

High-throughput Synthetic Genetic Array (eSGA) Screening:

  • Create a donor strain with a mutation in mdtI gene

  • Systematically transfer this mutation via conjugation to an arrayed collection of recipient knockout strains

  • Generate double mutants and assess their fitness under different growth conditions

  • Quantify genetic interactions using a multiplicative model to detect significant deviations from expected fitness

Data Analysis and Network Construction:

  • Calculate E-scores to measure the strength and confidence of genetic interactions

  • Identify alleviating interactions (positive E-scores) indicating genes operating in the same pathway

  • Detect aggravating interactions (negative E-scores) suggesting genes in parallel pathways or with compensatory functions

  • Construct functional association networks based on the pattern of interactions

Validation of Interactions:

  • Confirm high-confidence interactions through targeted genetic studies

  • Perform phenotypic assays such as growth curves and drug sensitivity tests

  • Examine cell morphology using microscopy and specific staining techniques

Research Applications:
Genetic interaction studies have revealed condition-specific functional dependencies underlying cell envelope assembly in E. coli. For example, comprehensive eSGA screens have identified:

  • Differential interaction patterns between rich (auxotrophic) and minimal (prototrophic) media

  • Functional crosstalk between transport systems and envelope biosynthetic pathways

  • Genetic backup mechanisms that ensure envelope integrity under stress conditions

Such approaches would be valuable for positioning MdtI within the broader functional architecture of bacterial transport systems and cell envelope processes.

What techniques are available for measuring spermidine export activity of recombinant MdtI in E. coli?

Several complementary techniques can be employed to measure the spermidine export activity of recombinant MdtI in E. coli:

Radioactive Transport Assays:

  • Preload cells expressing recombinant MdtI with [14C]spermidine

  • Resuspend cells in fresh buffer and monitor efflux over time

  • Take samples at regular intervals, remove cells by filtration or centrifugation

  • Measure radioactivity in both cell pellet and supernatant

  • Calculate export rates based on the decrease in cellular radioactivity

HPLC-based Polyamine Quantification:

  • Culture cells in media with defined spermidine concentrations

  • Harvest cells and media separately at various time points

  • Extract polyamines and derivatize for HPLC detection

  • Analyze intracellular and extracellular spermidine levels

  • Compare export rates between MdtI-expressing and control cells

Fluorescence-based Transport Assays:

  • Synthesize fluorescent spermidine derivatives

  • Monitor export using spectrofluorimetry or flow cytometry

  • Analyze kinetics of fluorescence decrease in cells

Indirect Measurement Through Cell Viability:

  • Challenge spermidine acetyltransferase-deficient cells (e.g., E. coli CAG2242) with toxic spermidine levels

  • Compare survival rates between cells expressing recombinant MdtI and controls

  • Construct dose-response curves for different spermidine concentrations

Data Interpretation Table:

TechniqueAdvantagesLimitationsTypical Data Output
Radioactive AssaysDirect measurement, high sensitivityRequires radioactive materials, safety concernsExport rate (nmol/min/mg protein)
HPLC AnalysisCan distinguish different polyamines, quantitativeLabor intensive, requires specialized equipmentConcentration (μM) vs. time curves
Fluorescence MethodsReal-time measurements possible, no radioactivityFluorescent derivatives may alter transport propertiesFluorescence units vs. time
Viability AssaysFunctional relevance, simple setupIndirect measure, influenced by other factorsSurvival percentage or colony counts

Research has demonstrated that E. coli cells expressing MdtJI show significantly enhanced excretion of accumulated [14C]spermidine compared to control cells, with measurable increases in extracellular spermidine levels after 40 minutes of incubation .

What approaches can be used to study the role of MdtI in multidrug-resistant E. coli strains?

Investigating the role of MdtI in multidrug-resistant (MDR) E. coli strains requires multifaceted approaches that span genetics, functional analysis, and clinical correlations:

Comparative Genomic Analysis:

  • Sequence mdtI and flanking regions from clinical MDR isolates

  • Compare with sensitive strains to identify polymorphisms or regulatory variants

  • Analyze whole-genome sequencing data to identify co-occurring resistance determinants

  • Examine copy number variations and mobile genetic elements that may influence mdtI expression

Expression Studies:

  • Measure mdtI transcript levels in MDR vs. sensitive strains using qRT-PCR

  • Perform RNA-seq analysis under various antibiotic stress conditions

  • Use reporter gene fusions to monitor mdtI promoter activity in different genetic backgrounds

Functional Characterization:

  • Generate mdtI knockout mutants in MDR strains using CRISPR-Cas9 or traditional methods

  • Assess changes in antimicrobial susceptibility profiles

  • Determine polyamine transport activity and homeostasis

  • Evaluate biofilm formation capacity and cell envelope integrity

In Vivo Competition Assays:

  • Use germ-free or antibiotic-treated mouse models

  • Compare colonization efficiency between wild-type and mdtI-deficient MDR strains

  • Perform competitive index experiments with mixed infections

  • Monitor bacterial population dynamics in different host environments

Correlation with Resistance Profiles:
Research indicates that MDR E. coli strains like ST410, ST671, and ST101 harbor numerous antibiotic resistance genes and display resistance to a wide array of antibiotics . Investigating whether MdtI contributes to this resistance phenomenon or represents an adaptation to the physiological stress of carrying resistance determinants would provide valuable insights.

Using these approaches can help determine whether MdtI represents a potential target for adjuvant therapies aimed at combating multidrug resistance in clinical E. coli isolates.

How can recombinant MdtI be effectively expressed, purified, and characterized for structural studies?

Structural studies of MdtI require optimized protocols for expression, purification, and characterization of the recombinant protein. The following methodological approach provides a comprehensive workflow:

Expression System Selection:

  • E. coli-based expression systems:

    • BL21(DE3) for high-level expression

    • C41(DE3) or C43(DE3) for membrane protein expression

    • Consider codon-optimized synthetic genes for improved expression

  • Expression vector design:

    • Include affinity tags (His6, Strep-tag II) for purification

    • Use inducible promoters (T7, tac) for controlled expression

    • Consider fusion partners (MBP, SUMO) to enhance solubility

Membrane Protein Expression Optimization:

  • Test multiple growth temperatures (18°C, 25°C, 30°C)

  • Optimize inducer concentration and induction timing

  • Evaluate different media compositions (TB, 2xYT, minimal media)

  • Consider auto-induction systems for gradual protein expression

Extraction and Purification Strategy:

  • Membrane isolation:

    • Cell disruption by sonication or high-pressure homogenization

    • Differential centrifugation to isolate membrane fractions

  • Detergent screening for solubilization:

    • Test mild detergents (DDM, LMNG, C12E8)

    • Optimize detergent concentration and solubilization time

  • Purification steps:

    • Immobilized metal affinity chromatography (IMAC)

    • Size exclusion chromatography for oligomeric state analysis

    • Ion exchange chromatography for final polishing

Biochemical and Biophysical Characterization:

  • Functional validation:

    • Reconstitution into proteoliposomes for transport assays

    • Substrate binding studies using ITC or fluorescence spectroscopy

  • Structural analysis:

    • Circular dichroism for secondary structure assessment

    • Thermal stability assays using differential scanning fluorimetry

    • Negative stain electron microscopy for initial structural screening

    • Crystallization trials or cryo-EM sample preparation

Protein Quality Assessment Table:

ParameterTechniqueAcceptance Criteria
PuritySDS-PAGE, Western blot>95% homogeneity
MonodispersitySize exclusion chromatographySingle symmetric peak
Thermal stabilityDifferential scanning fluorimetryTm >40°C in final buffer
Secondary structureCircular dichroismCharacteristic α-helical spectrum
Functional activitySpermidine transport assayActive compared to control

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.