Recombinant Escherichia coli O8 Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its implementation.
Synonyms
mdtJ; ECIAI1_1650; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
mdtJ
Target Protein Sequence
MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V
Uniprot No.

Target Background

Function

Function: Catalyzes the excretion of spermidine.

Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MdtJ protein and what is its primary function in E. coli?

MdtJ is a membrane protein that functions as part of the MdtJI complex in Escherichia coli. This complex belongs to the small multidrug resistance (SMR) family of drug exporters. The primary function of MdtJ, when complexed with MdtI, is to catalyze the excretion of spermidine from cells, protecting E. coli from the toxic effects of spermidine overaccumulation .

The MdtJI complex forms a specialized transport system that helps maintain proper polyamine homeostasis within the bacterial cell. When spermidine levels become elevated, this complex actively exports the excess spermidine, thereby preventing cellular toxicity that would otherwise inhibit growth and potentially lead to cell death .

How is the expression of mdtJ regulated in bacterial cells?

The expression of mdtJ appears to be regulated at the transcriptional level in response to spermidine concentrations. Research has demonstrated that the level of mdtJI mRNA increases when cells are exposed to spermidine . This suggests a feedback mechanism where the presence of the substrate (spermidine) induces the expression of its transport system.

This regulatory response allows E. coli to adapt to changing environmental conditions and maintain polyamine homeostasis by upregulating the spermidine export machinery when spermidine levels become elevated. This adaptive response is particularly important in strains that lack spermidine acetyltransferase activity, which would normally metabolize excess spermidine .

Which key amino acid residues are essential for MdtJ function?

Specific amino acid residues in MdtJ have been identified as critical for the protein's spermidine excretion activity. These include:

  • Tyrosine at positions 4 and 45 (Tyr4, Tyr45)

  • Tryptophan at position 5 (Trp5)

  • Glutamic acid at positions 15 and 82 (Glu15, Glu82)

  • Tyrosine at position 61 (Tyr61)

These residues likely participate in substrate recognition, binding, or the conformational changes necessary for transport. The identification of these specific amino acids suggests that they may form part of the substrate binding pocket or transport channel within the MdtJ protein structure .

How can Design of Experiments (DoE) approaches be applied to optimize MdtJ expression systems?

Design of Experiments (DoE) can be effectively applied to optimize recombinant MdtJ expression by systematically evaluating multiple variables simultaneously. Rather than using a one-factor-at-a-time (OFAT) approach, researchers can implement statistical modeling strategies such as response surface methodology (RSM) to identify optimal conditions .

For MdtJ expression optimization, a practical DoE approach would involve:

  • Screening Phase: Use Plackett-Burman or fractional factorial designs to identify significant factors affecting MdtJ expression from variables such as:

    • Promoter strength

    • Induction conditions (inducer concentration, timing)

    • Growth media composition

    • Temperature

    • Codon optimization strategies

  • Optimization Phase: Apply response surface methodology (Box-Behnken or central composite design) to find optimal levels for the significant factors identified in the screening phase.

  • Validation: Confirm the predicted optimal conditions through verification experiments .

This approach allows researchers to identify not only the main effects but also interaction effects between variables that influence MdtJ expression, leading to more robust optimization than traditional approaches .

What experimental methods can be used to assess MdtJ-mediated spermidine export activity?

Several complementary experimental approaches can be employed to assess MdtJ-mediated spermidine export:

  • Growth Recovery Assays: Measure the growth recovery of spermidine acetyltransferase-deficient E. coli strains (e.g., E. coli CAG2242) in the presence of high spermidine concentrations (e.g., 12 mM) when transformed with mdtJ and mdtI expression vectors. Growth curves can be monitored by measuring optical density at regular intervals .

  • Intracellular Polyamine Content Analysis: Quantify intracellular spermidine levels using HPLC or LC-MS/MS in cells with and without MdtJ expression when cultured in spermidine-containing media. A reduction in intracellular spermidine in MdtJ-expressing cells provides evidence of export activity .

  • Radioisotope Export Assays: Load cells with radiolabeled [14C]spermidine and measure its efflux rate over time in cells expressing MdtJ compared to control cells. This provides direct evidence of transport activity .

  • Site-Directed Mutagenesis: Systematically mutate the key amino acid residues identified in MdtJ (Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82) and assess the impact on transport activity using the methods above .

A comprehensive assessment should combine multiple approaches to provide robust evidence of MdtJ function.

How can researchers design experiments to study the interaction between MdtJ and MdtI proteins?

To study MdtJ-MdtI interactions, researchers can employ a multi-faceted experimental approach:

  • Co-expression and Co-purification: Express both proteins with different affinity tags and perform co-purification experiments to confirm physical interaction. This can be coupled with size-exclusion chromatography to determine the stoichiometry of the complex.

  • Bacterial Two-Hybrid Assays: Use bacterial two-hybrid systems to assess protein-protein interactions in vivo.

  • Split Complementation Assays: Design split reporter systems (such as split GFP or split β-lactamase) fused to MdtJ and MdtI to visualize and quantify their interaction.

  • Functional Complementation: Test whether expressing mdtJ alone, mdtI alone, or both together rescues spermidine toxicity in susceptible E. coli strains. Evidence shows that both proteins are required for functionality, suggesting they form an obligate complex .

  • Cross-linking Studies: Perform chemical cross-linking followed by mass spectrometry to identify interacting residues between the two proteins.

  • Randomized Factorial Designs: Apply DoE principles to study how mutations in both proteins simultaneously affect function, which may reveal epistatic interactions .

How does the structure of MdtJ contribute to its specificity for spermidine export?

While the complete three-dimensional structure of MdtJ has not been fully elucidated, several approaches can be used to investigate structure-function relationships:

  • Comparative Homology Modeling: Generate structural models based on related proteins with known structures in the SMR family. These models can predict the arrangement of transmembrane helices and the formation of a potential transport channel.

  • Site-directed Mutagenesis: Systematic mutation of specific residues (particularly the identified key residues Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82) followed by functional assays can map the substrate binding pocket and transport pathway .

  • Substrate Specificity Assessment: Test the ability of MdtJI to transport other polyamines (putrescine, cadaverine, spermine) and structurally related compounds to define the chemical requirements for substrate recognition.

  • Molecular Dynamics Simulations: Perform computational simulations of spermidine interaction with the modeled MdtJ structure to predict binding modes and conformational changes during transport.

  • Cysteine Scanning Mutagenesis: Replace individual amino acids with cysteine residues and use accessibility reagents to map exposed regions and conformational changes during the transport cycle.

The combination of these approaches can provide insights into how specific structural features of MdtJ enable selective recognition and transport of spermidine.

What analytical methods can be used to quantify MdtJ-mediated changes in cellular polyamine profiles?

To comprehensively quantify changes in cellular polyamine profiles mediated by MdtJ expression, researchers can employ several analytical approaches:

Table 1: Analytical Methods for Polyamine Quantification

MethodDescriptionAdvantagesLimitations
HPLC with post-column derivatizationSeparation of polyamines followed by fluorescent derivatizationHigh sensitivity, established protocolsRequires specialized equipment
LC-MS/MSLiquid chromatography coupled with tandem mass spectrometryHigh specificity, can identify novel polyamine conjugatesExpensive instrumentation, complex data analysis
Radioisotope labelingUse of [14C] or [3H]-labeled polyaminesDirect measurement of transport kineticsRequires radioactive materials handling
Enzymatic assaysCoupled enzyme reactions that produce measurable signalsCan be adapted to high-throughput formatsMay have lower specificity

When measuring intracellular polyamine contents, it's important to:

  • Include appropriate controls (vector-only, mdtJ-only, mdtI-only, and mdtJI)

  • Normalize measurements to total protein content or cell number

  • Account for growth phase effects, as polyamine content can vary with growth stage

  • Consider the impact of exogenous polyamines in the culture medium

How can transcriptomics and proteomics approaches enhance our understanding of MdtJ regulation?

Integrating omics approaches can provide comprehensive insights into MdtJ regulation:

  • Transcriptomics:

    • RNA-Seq analysis comparing wild-type and spermidine-stressed conditions can identify co-regulated genes

    • Chromatin immunoprecipitation sequencing (ChIP-seq) can identify transcription factors binding to the mdtJ promoter region

    • Ribosome profiling can assess translational regulation of mdtJ

  • Proteomics:

    • Quantitative proteomics using techniques like SILAC or TMT labeling can measure MdtJ protein levels under different conditions

    • Phosphoproteomics can identify post-translational modifications that may regulate MdtJ activity

    • Protein-protein interaction studies using proximity labeling (BioID or APEX) can identify novel interaction partners

  • Integrated Multi-omics:

    • Correlate changes in mdtJ transcript levels with protein levels to identify translational regulation

    • Map the entire regulatory network controlling polyamine homeostasis, including MdtJ

    • Identify feedback mechanisms between polyamine levels and MdtJ expression

These approaches can reveal how E. coli coordinates MdtJ expression with other cellular processes in response to changing polyamine levels.

What are the optimal expression systems for recombinant MdtJ production?

For successful recombinant MdtJ production, researchers should consider the following expression systems and optimization strategies:

  • Expression Host Selection:

    • BL21(DE3) derivatives are often suitable for membrane protein expression

    • C41(DE3) and C43(DE3) strains were specifically developed for toxic membrane proteins

    • Consider using a host with reduced proteolytic activity (e.g., BL21(DE3) pLysS)

  • Expression Vector Design:

    • Use vectors with tunable promoter strengths (T7-lac, araBAD)

    • Consider fusion partners that can enhance membrane targeting and folding

    • Include purification tags that can be cleaved post-purification

    • Co-express MdtI when studying the functional complex

  • Induction and Growth Conditions:

    • Lower temperatures (16-25°C) often improve membrane protein folding

    • Use lower inducer concentrations for slower, more controlled expression

    • Consider auto-induction media for gradual protein production

  • Membrane Extraction and Purification:

    • Optimize detergent selection for extraction (e.g., DDM, LMNG)

    • Use affinity chromatography followed by size exclusion for purification

    • Consider nanodiscs or lipid reconstitution for functional studies

A systematic DoE approach can efficiently optimize these variables simultaneously rather than testing them individually .

How should researchers analyze contradictory data regarding MdtJ function?

When facing contradictory data about MdtJ function, researchers should follow these methodological approaches:

  • Reproducibility Assessment:

    • Verify experimental conditions and protocols for consistency

    • Replicate experiments with larger sample sizes to increase statistical power

    • Ensure proper controls are included in all experiments

  • Strain and Genetic Background Analysis:

    • Consider if contradictions arise from differences in E. coli strains used

    • Check for potential suppressor mutations that might affect results

    • Verify the genetic constructs used for MdtJ expression

  • Methodological Triangulation:

    • Apply multiple independent techniques to measure the same phenomenon

    • For example, combine growth assays, direct spermidine measurements, and transport assays

    • Use both in vivo and in vitro approaches when possible

  • Statistical Analysis:

    • Implement robust statistical methods like meta-d' analysis to separate true sensitivity effects from response bias effects

    • Apply appropriate statistical tests based on data distribution

    • Consider Bayesian approaches to integrate multiple sources of evidence

  • Systematic Documentation:

    • Maintain detailed laboratory records of all experimental conditions

    • Document all software settings and analysis parameters

    • Use structured data formats to facilitate comparison across experiments

By systematically addressing potential sources of contradiction, researchers can develop a more nuanced understanding of MdtJ function.

What statistical approaches are most appropriate for analyzing MdtJ functional data?

When analyzing functional data related to MdtJ, several statistical approaches are particularly valuable:

How does the MdtJI complex integrate with other polyamine homeostasis systems in E. coli?

The MdtJI complex functions within a broader network of polyamine homeostasis systems in E. coli. Understanding these interactions involves investigating:

  • Coordination with Polyamine Biosynthesis:

    • Explore how MdtJI expression relates to the activity of key biosynthetic enzymes like ornithine decarboxylase (SpeC) and S-adenosylmethionine decarboxylase (SpeD)

    • Investigate whether feedback mechanisms exist between export and synthesis pathways

  • Relationship with Polyamine Metabolism:

    • Study how MdtJI interacts with spermidine acetyltransferase (SpeG), the enzyme that normally metabolizes excess spermidine

    • Determine if MdtJI serves as a backup mechanism when metabolic pathways are overwhelmed, or if it has distinct regulatory triggers

  • Integration with Polyamine Transport Systems:

    • Analyze potential functional overlap with other polyamine transporters

    • Investigate whether these systems show complementary expression patterns or substrate preferences

  • Response to Environmental Stressors:

    • Examine how oxidative stress, pH changes, or osmotic stress affect MdtJI expression relative to other polyamine homeostasis components

    • Determine if MdtJI plays a specialized role in certain stress responses

Understanding these interactions could reveal how E. coli coordinates different regulatory mechanisms to maintain optimal polyamine levels under various environmental conditions.

What experimental approaches can identify novel inhibitors of MdtJ function?

To identify potential inhibitors of MdtJ function, researchers can implement several complementary approaches:

  • High-throughput Screening Assays:

    • Develop growth-based screens using spermidine-sensitive E. coli strains expressing MdtJI

    • Compounds that inhibit MdtJI would prevent growth rescue in high-spermidine conditions

    • Implement fluorescence-based assays using membrane-permeable polyamine sensors

  • Structure-based Virtual Screening:

    • Generate homology models of MdtJ based on related transporters

    • Perform in silico docking of compound libraries to identify potential binders

    • Prioritize compounds that interact with the identified key residues (Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82)

  • Fragment-based Drug Discovery:

    • Screen fragment libraries for binding to purified MdtJ protein

    • Use biophysical techniques like surface plasmon resonance (SPR) or differential scanning fluorimetry (DSF) to detect binding

    • Develop fragment hits into more potent lead compounds

  • Peptidomimetic Approaches:

    • Design peptides that mimic interaction interfaces between MdtJ and MdtI

    • Test their ability to disrupt complex formation and inhibit function

  • Transport Assay Validation:

    • Confirm activity of potential inhibitors using direct transport assays with radiolabeled spermidine

    • Determine inhibition kinetics (competitive, non-competitive, or uncompetitive)

These approaches could lead to the development of chemical probes for studying MdtJ function and potentially novel antimicrobial strategies targeting polyamine homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.