Recombinant Escherichia coli O8 Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; ECIAI1_3205; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
uppP
Target Protein Sequence
MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPLQHEGESKGRLTLIHILLGMIPAVVLGLLFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGFLTTGDIPMFAVGFITAFVVALI AIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its role in bacterial cell wall synthesis?

Undecaprenyl pyrophosphate phosphatase (UppP), also known as BacA, is an integral membrane protein that catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP). This reaction is essential for bacterial cell wall biosynthesis, particularly for the production of peptidoglycan, O-antigen, and teichoic acid .

UP serves as a critical carrier lipid in bacterial cell wall synthesis. It functions by binding to hydrophilic sugar moieties to form lipid intermediates that are subsequently translocated across the cytoplasmic membrane during polysaccharide biosynthesis . In peptidoglycan synthesis specifically, UP reacts with uridine diphosphate N-acetyl muramic acid pentapeptide to form lipid I at the inner side of the cytoplasmic membrane, which is a crucial step in the construction of the bacterial cell wall .

The significance of this enzyme cannot be overstated, as the presence of at least one type of UPP phosphatase is essential for bacterial growth and survival . This makes UppP an attractive target for antimicrobial drug development, particularly in the face of rising antibiotic resistance.

How are UppP enzymes structurally characterized in Escherichia coli?

The Escherichia coli UppP enzyme is characterized by two consensus regions containing distinctive motifs that are crucial for its function. The first is a glutamate-rich (E/Q)XXXE motif, and the second includes a PGXSRSXXT sequence . Additionally, a histidine residue plays an important role in the enzyme's activity.

Research indicates that the enzyme's active site is located on the periplasmic side of the bacterial membrane, which has significant implications for understanding its mechanism of action and for developing potential inhibitors . The enzyme has been purified using various chromatographic techniques, including TSK-DEAE, ceramic hydroxyapatite, TSK-ether, Superdex 200, and heparin-Actigel chromatography, revealing a protein with an apparent molecular mass of approximately 29 kDa .

Current structural knowledge has been derived through a combination of techniques including protein purification, sequence alignment, modeling, molecular dynamics simulations, and mutagenesis studies. The enzyme requires Triton X-100 and MgCl₂ for activity, highlighting specific requirements for proper function .

What expression systems and purification methods are most effective for recombinant Escherichia coli UppP?

For successful expression of recombinant E. coli UppP, the following protocol has proven effective:

  • Transformation of the expression vector containing the uppP gene into E. coli C41(DE3) strain

  • Culture growth in LB medium with 100 mg/ml ampicillin at 37°C

  • Induction with 0.5 mM isopropyl β-d-thiogalactoside when A₆₀₀ reaches approximately 0.9

  • Addition of 5-10 mM all-trans-retinal during induction

  • Continued incubation at 37°C for 5 hours

For purification, researchers have successfully implemented the following strategy:

  • Cell harvesting and resuspension in buffer (50 mM Tris, pH 7.5, 500 mM NaCl)

  • Cell disruption using mechanical methods (e.g., Constant Cell Disruption Systems)

  • Membrane collection via ultracentrifugation at 40,000 rpm for 1.5 hours

  • Membrane solubilization in buffer containing 1% (w/v) n-dodecyl-β-D-maltoside

  • For His-tagged versions, purification via Ni²⁺ affinity chromatography

  • For untagged versions, purification using a two-step chromatographic approach

Both His-tagged and untagged versions of the enzyme have demonstrated comparable activity levels, offering researchers flexibility in experimental design .

What assays are used to measure Undecaprenyl-diphosphatase activity?

The most commonly employed method for measuring UppP activity is a phosphate colorimetric assay. The standard reaction mixture (200 μl) contains:

  • 50 mM Hepes buffer (pH 7.0)

  • 150 mM NaCl

  • 10 mM MgCl₂

  • Appropriate substrate concentration

  • Purified enzyme

The phosphate released during the enzymatic reaction is quantified using commercially available phosphate detection kits (such as the BioVision colorimetric assay kit). This method allows for reliable assessment of enzyme activity under various experimental conditions.

Other approaches may include radiometric assays using labeled substrates or coupling the reaction to other detectable enzymatic processes. When reporting activity, researchers typically express results as specific activity (μmol phosphate released per minute per mg of protein) or as relative activity compared to wild-type enzyme.

Assay TypeAdvantagesLimitationsTypical Application
ColorimetricSimple, non-radioactive, quantitativePotential interference from sample componentsRoutine activity measurements
RadiometricHigh sensitivity, direct measurementRequires special handling of radioactive materialsKinetic studies
Coupled enzymeCan monitor reaction in real-timeRequires optimization of coupling systemContinuous monitoring applications

How should researchers design experiments to study the structure-function relationship of Escherichia coli Undecaprenyl-diphosphatase?

Designing robust experiments to investigate structure-function relationships of E. coli UppP requires a multidisciplinary approach combining biochemical, biophysical, and computational methods:

  • Site-directed mutagenesis: Target the conserved (E/Q)XXXE and PGXSRSXXT motifs and the essential histidine residue identified through sequence alignments . Systematically substitute these residues with alanine or functionally similar amino acids to assess their contributions to catalysis.

  • Protein crystallography: While challenging for membrane proteins, techniques such as lipidic cubic phase crystallization have proven successful for similar proteins. The existing apo-undecaprenyl pyrophosphate synthase structure provides valuable insights for comparative modeling .

  • Molecular dynamics simulations: Simulate the enzyme in a membrane environment to understand conformational changes during catalysis, substrate binding, and the role of specific residues in the active site .

  • Biochemical characterization: For each mutant variant, determine:

    • Specific activity

    • Substrate binding affinity (Km)

    • Catalytic efficiency (kcat/Km)

    • pH-rate profiles

    • Metal ion dependency

  • Inhibitor studies: Use competitive and non-competitive inhibitors to probe active site architecture and allosteric regulation mechanisms .

A critical experimental design consideration is the inclusion of appropriate controls, particularly given the membrane-bound nature of UppP. Wild-type enzyme should be processed identically to mutant variants, and activity measurements should account for potential differences in expression levels or protein stability.

What approaches can be used to resolve contradictory data when studying Undecaprenyl-diphosphatase?

When facing contradictory data in UppP research, a systematic troubleshooting approach is essential:

  • Reevaluate experimental design: Small decisions in experimental design can significantly impact outcomes. Assess control group selection, variable definition, and statistical analysis methods . As Emily Anthes noted, "tiny decisions about experimental design can affect the outcome of a study–and begins to illuminate why studies may contradict one another" .

  • Examine data thoroughly: Identify discrepancies and outliers that may influence results. Compare findings with existing literature and previous studies on UppP or related enzymes .

  • Consider alternative hypotheses: Rather than dismissing contradictory data, develop new hypotheses that could explain the observed discrepancies. As noted in one study, "In formal logic, a contradiction is the signal of defeat, but in the evolution of real knowledge, it marks the first step in progress" .

  • Assess confirmation bias: Be aware that preconceived expectations can influence data interpretation. Studies have shown that researchers expecting a particular correlation were more than twice as likely to report detecting it than those expecting an opposite trend .

  • Refine variable definitions: Ensure that all parameters (enzyme activity, substrate concentration, etc.) are consistently defined and measured across experiments.

  • Implement additional controls: Include internal standards, alternative assay methods, and biological replicates to validate findings.

The complex membrane-associated nature of UppP presents particular challenges that may lead to seemingly contradictory results when using different detergents, expression systems, or assay conditions. Documenting and reporting these variables thoroughly is essential for reproducibility.

How can molecular dynamics simulations enhance our understanding of Undecaprenyl-diphosphatase's catalytic mechanism?

Molecular dynamics (MD) simulations provide valuable insights into UppP's catalytic mechanism by:

  • Modeling membrane interaction: MD simulations allow researchers to observe how UppP integrates into the lipid bilayer and how this affects substrate access and product release .

  • Revealing conformational changes: Simulations can capture transient conformational states during catalysis that may be difficult to observe experimentally, particularly the movements of the (E/Q)XXXE and PGXSRSXXT motifs during substrate binding and product release.

  • Probing proton transfer: MD simulations, particularly those utilizing quantum mechanics/molecular mechanics (QM/MM) approaches, can elucidate the proton transfer mechanism during the dephosphorylation reaction.

  • Water dynamics: Understanding the role of water molecules in the active site is crucial for enzymatic hydrolysis reactions. MD simulations can track water molecule positioning and dynamics during catalysis.

  • Substrate recognition: Simulations can reveal how UppP specifically recognizes undecaprenyl pyrophosphate among other cellular phospholipids.

A recommended MD simulation protocol would include:

  • A properly parametrized membrane environment

  • Explicit solvent representation

  • Physiologically relevant ion concentrations

  • Microsecond-scale simulation time to capture relevant dynamics

  • Multiple independent simulation runs to ensure statistical significance

The results from such simulations should be validated against experimental data, such as the effects of specific mutations on enzyme activity or the behavior of the enzyme under different pH conditions.

What are the best strategies for developing inhibitors targeting Undecaprenyl-diphosphatase?

Developing effective UppP inhibitors represents a promising avenue for new antibacterial agents, particularly against drug-resistant bacteria. The following strategies have proven effective:

  • Structure-based virtual screening: Using validated UPPS crystal structures as templates, researchers have successfully identified inhibitors through virtual screening of large compound libraries. In one study, screening 450,000 compounds yielded 100 virtual hits that were subsequently assayed against UPPS from S. aureus and E. coli, with the most promising compounds showing IC₅₀ values around 2 μM and K_i values of approximately 300 nM .

  • Targeting conserved motifs: Design inhibitors that interact with the highly conserved (E/Q)XXXE and PGXSRSXXT motifs and the essential histidine in the active site .

  • Exploiting synergistic effects: Some compounds exhibit strong synergism with existing antibiotics. For example, one rhodanine compound (structurally similar to the diabetes drug epalrestat) showed a fractional inhibitory concentration index (FICI) of 0.1 with methicillin against MRSA USA300 strain .

  • Antimicrobial spectrum considerations: Effective inhibitors have demonstrated activity against multiple pathogenic bacteria, including MRSA, Listeria monocytogenes, Bacillus anthracis, and vancomycin-resistant Enterococcus species, with MIC or IC₅₀ values in the 0.25–4 μg/mL range .

Bacterial SpeciesMIC Range (μg/mL)Clinical Significance
MRSA0.25-2Major cause of hospital and community-acquired infections
Listeria monocytogenes1-4Causes listeriosis, particularly dangerous for immunocompromised individuals
Bacillus anthracis0.5-2Causative agent of anthrax
Vancomycin-resistant Enterococcus1-4Significant hospital-acquired infection risk

When developing and testing potential inhibitors, researchers should assess both the direct inhibition of UppP and the effects on bacterial viability, membrane integrity, and cell wall synthesis.

How can researchers differentiate between the functional roles of BacA homologues and PAP2 homologues in UPP dephosphorylation?

Differentiating the roles of BacA homologues and type-2 phosphatidic acid phosphatase (PAP2) homologues in UPP dephosphorylation requires specialized experimental approaches:

  • Genetic knockouts and complementation: Create single and double knockout strains of both enzyme types, followed by complementation studies. While the presence of one UPP phosphatase is essential for bacterial growth, understanding the specific contribution of each enzyme type requires careful genetic manipulation .

  • Enzyme kinetics comparison: Determine and compare the kinetic parameters (Km, Vmax, kcat) of purified BacA and PAP2 enzymes under identical conditions to evaluate their catalytic efficiencies and substrate preferences.

  • Substrate specificity profiling: Test both enzyme types against a panel of substrates (UPP, various phospholipids, etc.) to determine their specificity profiles.

  • Localization studies: Both enzyme types have catalytic centers located outside the cytoplasmic membrane, but they may occupy distinct membrane microdomains. Fluorescence microscopy with tagged proteins can reveal their spatial distribution .

  • Response to environmental conditions: Monitor the expression and activity of both enzyme types under various growth conditions, stress factors, and antibiotic challenges to determine if they serve complementary or redundant functions.

  • Structural comparison: Analyze structural differences between BacA and PAP2 enzymes to identify unique features that might explain functional divergence.

It's important to note that these enzymes may have evolved to function under different physiological conditions or to process slightly different substrate variants, which could explain the maintenance of both enzyme types throughout bacterial evolution .

What are the current challenges in crystallizing membrane proteins like Undecaprenyl-diphosphatase?

Membrane proteins like UppP present significant crystallization challenges due to their hydrophobic nature and requirement for a lipid environment. Current challenges and strategies include:

  • Protein stability: Maintaining the stability of UppP outside its native membrane environment is challenging. Researchers have employed various detergents and lipid mimetics to stabilize the protein during purification and crystallization attempts .

  • Conformational heterogeneity: Membrane proteins often exhibit conformational flexibility, complicating crystallization efforts. Engineering more rigid variants through strategic disulfide bonds or binding partners can enhance crystal formation.

  • Crystal contacts: The large hydrophobic surfaces of membrane proteins limit potential crystal contacts. Techniques such as antibody fragment co-crystallization or fusion protein approaches can provide additional hydrophilic surfaces for crystal formation.

  • Lipidic environments: Advanced crystallization methods such as lipidic cubic phase (LCP) or bicelle crystallization provide more native-like environments for membrane proteins and have proven successful for similar proteins.

  • Diffraction quality: Crystals of membrane proteins often diffract poorly. Dehydration, annealing, or heavy atom soaking can sometimes improve diffraction quality.

Despite these challenges, the recent success in obtaining X-ray crystallographic structures of related enzymes, such as the Escherichia coli apo-undecaprenyl pyrophosphate synthase , suggests that similar approaches might be applicable to UppP.

How does Undecaprenyl phosphate metabolism differ between Gram-positive and Gram-negative bacteria?

Understanding the differences in Undecaprenyl phosphate metabolism between Gram-positive and Gram-negative bacteria is crucial for developing targeted antimicrobial strategies:

  • Undecaprenol (UOH) presence: Gram-positive bacteria contain significant amounts of undecaprenol (UOH), which is phosphorylated to UP. In contrast, UOH has not been detected in Gram-negative bacteria, suggesting fundamental differences in UP metabolism pathways .

  • UOH kinase: In Gram-positive bacteria, an enzyme homologous to DgkA (the diacylglycerol kinase of E. coli) catalyzes UOH phosphorylation. This pathway appears to be absent in Gram-negative bacteria .

  • UP recycling: While both bacterial types recycle UP through dephosphorylation of UPP via either a BacA homologue or a PAP2 homologue, the relative importance of these enzymes may differ between Gram-positive and Gram-negative species .

  • Membrane architecture: The different membrane architectures between these bacterial types (single membrane in Gram-positive vs. double membrane in Gram-negative) likely influence the localization and regulation of the enzymes involved in UP metabolism.

  • Teichoic acid requirements: Gram-positive bacteria use UP for teichoic acid synthesis, a cell wall component absent in Gram-negative bacteria, potentially creating different demands on UP availability .

These differences present potential opportunities for selective targeting of Gram-positive or Gram-negative pathogens through inhibitors designed to exploit the unique aspects of their UP metabolism pathways.

What are the most promising future research directions for Escherichia coli Undecaprenyl-diphosphatase studies?

Several promising research directions for E. coli UppP warrant further investigation:

  • Structural biology advancements: Obtaining high-resolution structures of UppP in different conformational states using advanced techniques like cryo-electron microscopy would significantly enhance our understanding of its mechanism.

  • Integration with cell wall synthesis machinery: Investigating how UppP interacts with other enzymes involved in peptidoglycan biosynthesis could reveal important regulatory mechanisms and potential targets for combination therapy approaches.

  • Rational drug design: With improved structural information, structure-based design of specific UppP inhibitors could lead to novel antibiotics that circumvent existing resistance mechanisms.

  • Bacterial resistance mechanisms: Understanding how bacteria might develop resistance to UppP inhibitors would be valuable for designing more robust therapeutic strategies.

  • Systems biology approaches: Quantitative models of bacterial cell wall synthesis incorporating UppP activity could provide insights into system-level responses to perturbations and identify optimal intervention points.

  • Comparative studies across bacterial species: Expanding UppP research beyond E. coli to include important pathogens would reveal species-specific features that could be exploited for targeted antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.