Recombinant Escherichia coli O8 Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
uspB; ECIAI1_3638; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
uspB
Target Protein Sequence
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
Uniprot No.

Target Background

Database Links
Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Universal stress protein B (uspB) and how is it characterized in E. coli stress response?

Universal stress protein B (uspB) is part of the Universal stress protein (USP) family in E. coli that is significantly overexpressed under unfavorable environmental conditions. Unlike other USPs that have specific roles in oxidative stress resistance or iron scavenging, uspB appears to be more broadly involved in general stress responses .

USPs in E. coli can be categorized into different classes based on their functions:

  • Class I (USPA and USPD): primarily involved in oxidative stress resistance and iron scavenging

  • Class II (USPF and USPG): participate in oxidative stress response, but also play roles in cellular adhesion and motility

The uspB protein contributes to cellular survival mechanisms during nutrient starvation, temperature shock, oxidative stress, and exposure to antibiotics, though its exact mechanisms remain an area of active investigation .

How does uspB expression change under different stress conditions?

Studies have demonstrated that uspB expression is significantly upregulated under multiple stress conditions. According to transcriptomic analyses, uspB is one of the genes consistently upregulated during:

  • Heat shock

  • Cold shock

  • Oxidative stress

  • Nitrosative stress

  • Antibiotic treatment

In a comprehensive gene network analysis, uspB was identified among the 15 uncharacterized function genes that show elevated transcription in response to multiple stressors, suggesting it plays a pivotal role in general stress response . The upregulation appears to occur at a posttranscriptional level for some stress conditions, particularly heat shock .

What experimental methods are recommended for studying uspB expression?

To effectively study uspB expression, researchers typically employ multiple complementary approaches:

Transcriptomic Analysis:

  • RNA sequencing (RNA-seq) to quantify uspB mRNA levels under different conditions

  • Quantitative RT-PCR for targeted expression analysis

  • Microarray analysis for global gene expression patterns

Protein Detection:

  • Western blotting with anti-uspB antibodies

  • Fluorescent western blotting for quantitative analysis

  • MALDI analysis for protein identification and quantification

Functional Analysis:

  • Gene knockout studies (ΔuspB strains)

  • Complementation experiments

  • Growth rate comparisons between wild-type and mutant strains under stress conditions

For comprehensive analysis, implementing a combinatorial screening approach is recommended, as demonstrated in studies of other stress proteins in E. coli .

What strategies optimize recombinant expression of uspB in E. coli?

Recombinant expression of uspB requires careful consideration of several factors to maximize yield and functionality:

Expression System Selection:
For uspB expression, consider the following approaches based on experimental goals:

Expression StrategyAdvantagesRecommended When
Cytoplasmic expressionHigher yield potential, simpler processNo disulfide bonds required; protein is soluble
Periplasmic expressionEnables disulfide bond formation, facilitates isolation, controls N-terminus natureProtein requires oxidative environment; proteolysis is a concern
Secretion to mediumMinimizes toxicity, facilitates purificationProtein is toxic to host; high purity is required

Strain Selection:
Several engineered E. coli strains are beneficial for uspB expression:

  • BL21(DE3): Standard expression strain with reduced protease activity

  • C41(DE3) and C43(DE3): Walker strains with improved tolerance for potentially toxic proteins

  • Origami or SHuffle strains: For disulfide bond formation if required

Expression Optimization:

  • Use tunable promoters (like the rhamnose promoter) to precisely control expression levels

  • Consider codon optimization based on E. coli codon usage

  • Test multiple induction conditions (temperature, inducer concentration, duration)

  • Monitor cell viability and growth curves during expression

How can researchers enhance periplasmic production yields of recombinant uspB?

To maximize periplasmic expression yields of uspB, implement a systematic approach:

Signal Peptide Selection and Engineering:
Test multiple signal peptides empirically as their effectiveness varies by target protein:

  • DsbA signal peptide: Generally assumed to mediate co-translational targeting

  • Hbp signal peptide: Derived from Hemoglobin protease, co-translationally targeted

  • OmpA signal peptide: Targets post-translationally via SecB-dependent manner

  • PhoA signal peptide: Can work via both post- and co-translational pathways

Combinatorial Screening Approach:
A systematic screening method as illustrated in Figure 4 from source is recommended:

  • Construct fusion genes with different signal peptides

  • Transform into appropriate E. coli strain (consider Δrha background for rhamnose promoter)

  • Test expression at varying inducer concentrations

  • Monitor periplasmic localization using fractionation techniques

  • Compare production yields across conditions to identify optimal parameters

Host Cell Engineering:

  • Consider co-expression with chaperones (DsbA/DsbC) to enhance proper folding

  • Monitor and potentially increase SecA, LepB, and YidC levels to enhance secretory capacity

  • For difficult proteins, engineered strains with increased periplasmic folding capacity may be necessary

How can contradictory results in uspB expression studies be reconciled through experimental design?

Contradictory results in uspB research can stem from various factors. Use activity theory's principle of contradictions to systematically address these issues:

Identify Contradiction Sources:

  • Different E. coli strains used (K-12 vs. B strains, wild-type vs. engineered)

  • Varying growth conditions affecting basal expression levels

  • Different analytical techniques with varying sensitivities

  • Time point selection for analysis (transient vs. steady-state responses)

Experimental Design Recommendations:

  • Single-Subject Experimental Design (SSED): Implement SSED approach with appropriate A-B-A or withdrawal designs to establish causal relationships between specific variables and uspB expression

  • Visual Analysis Parameters: Evaluate results using comprehensive visual analysis considering:

    • Level changes between conditions

    • Trend changes within and across phases

    • Latency of response

    • Variability within conditions

  • Multi-phase Verification: If contradictions persist, implement phases as shown below:

PhasePurposeDesign Considerations
Baseline (A)Establish natural uspB expressionMultiple measurements, stable conditions
Intervention (B)Apply stress conditionControlled introduction of single variable
Withdrawal (A)Return to baselineVerify reversibility of response
Reintroduction (B)Reapply interventionConfirm reproducibility of response
  • Controlled Variables: Document and standardize:

    • Growth phase of cultures (early log, mid-log, stationary)

    • Media composition (minimal vs. rich)

    • Environmental conditions (temperature, pH, oxygen levels)

    • Sample processing procedures

What methodologies are effective for studying uspB in the context of multi-stress response pathways?

To investigate uspB's role in complex stress response networks, implement systems biology approaches:

Transcriptomic Integration:

  • Apply rank normalization to transcriptomic data across multiple stress conditions

  • Identify common differentially expressed genes (DEGs) between different stressors

  • Map uspB interactions within stress response networks

According to research findings, significant overlap exists in transcriptional responses to multiple stressors. For example, there are:

  • 683 upregulated genes common between antibiotic treatment and oxidative stress

  • 431 between antibiotic treatment and heat stress

  • 436 between antibiotic treatment and cold stress

  • 120 between nitrosative and antibiotic treatment stress

Pathway Analysis:
The following table summarizes key pathways and genes involved in multiple stress responses, including uspB:

Cellular ResponseNumber of GenesKey GenesHeatColdOxidativeNitrosativeAntibiotic
DNA damage8ycgB, blc, gadX, gadW, yqjI, iraD, sulA, ybaV×××××
Stress4rmf, uspG, mqsA, bolA×××××
Oxidative stress1grxA××××
Acid stress5slp, ydeP, ygaC, ycgZ, mgrB××××
Osmotic stress1osmB×××××
Phosphate starvation1psiE××××
Heat1ldhA××××
Nitrogen starvation1yeaG××××

Table adapted from source , showing genes involved in multiple stress responses

What structural characteristics distinguish uspB from other Universal stress proteins?

The structural characteristics of uspB can be investigated through comparative analysis with other USP family members:

Domain Architecture:
USPs can exist as:

  • Single-domain proteins

  • Multi-domain proteins with USP domain duplications (like PA1789 from P. aeruginosa)

  • Fusion proteins with other functional domains (protein kinase domains in plants)

UspB contains one USP domain with the characteristic α/β subdomain structure important for stress defense signaling .

ATP Binding Classification:
USPs are categorized based on ATP binding capability:

  • ATP-binding USPs (UspFG-type)

  • Non-ATP-binding USPs (UspAs and UspA-like group)

Structural studies indicate uspB belongs to the non-ATP-binding category, affecting its functional mechanisms .

Crystal Structure Analysis:
Of the 26 USP crystal structures available in the Protein Data Bank (PDB), structural comparisons reveal key differences in:

  • Active site conformations

  • Potential ligand binding pockets

  • Oligomerization interfaces

These structural features provide insights into uspB's specific functions in stress response pathways and can guide structure-based drug design or protein engineering efforts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.