Recombinant Escherichia coli O8 UPF0060 membrane protein ynfA (ynfA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O8 UPF0060 Membrane Protein ynfA (ynfA)

The Recombinant Escherichia coli O8 UPF0060 membrane protein ynfA (ynfA) is a protein expressed in Escherichia coli and belongs to the UPF0060 family. It is a membrane protein with a full length of 108 amino acids, fused to an N-terminal His tag for easier purification and identification . This protein is often used in research settings to study membrane protein functions and interactions.

Research Findings and Applications

While specific research on the Recombinant Escherichia coli O8 UPF0060 membrane protein ynfA (ynfA) is limited, studies on similar proteins suggest that membrane proteins like ynfA play crucial roles in bacterial cell membrane functions, including transport and signaling. The His-tagged version facilitates its use in biochemical assays and structural studies.

Similar Proteins and Their Functions

Proteins similar to ynfA, such as efflux transporters, are known to contribute to bacterial resistance against antimicrobial compounds. For example, YnfA in Shigella flexneri acts as an efflux pump, aiding in the transport of cationic compounds like ethidium bromide and acriflavine, thus conferring resistance .

Expression and Purification

Recombinant Escherichia coli O8 UPF0060 membrane protein ynfA (ynfA) is typically expressed in E. coli using standard recombinant DNA technology. The His tag allows for efficient purification using nickel affinity chromatography. This method is widely used for producing high-purity membrane proteins for structural and functional studies.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ynfA; ECIAI1_1632; UPF0060 membrane protein YnfA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
ynfA
Target Protein Sequence
MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY AAYGGVYVCTALMWLRVVDGVKLTLYDWTGALIALCGMLIIVAGWGRT
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Recombinant Escherichia coli O8 UPF0060 membrane protein ynfA (ynfA)?

    Recombinant YnfA is an efflux transporter protein belonging to the Small Multidrug Resistance (SMR) family. It is characterized as an 11.9 kDa integral inner membrane protein comprised of 108 amino acids. The recombinant form refers to the protein that has been expressed using genetic engineering techniques, typically with an N-terminal His-tag to facilitate purification and downstream applications. This protein functions as an active multidrug transporter that contributes to antimicrobial resistance in bacterial species .

    The commercially available recombinant YnfA protein (catalog number RFL18739EF) is expressed in E. coli expression systems and supplied as a lyophilized powder, making it suitable for various research applications focusing on membrane transport mechanisms and antimicrobial resistance .

  • What structural features characterize the YnfA protein?

    YnfA exhibits several key structural characteristics that define its function:

    Structural FeatureDescription
    Size108 amino acids, 11.9 kDa
    Transmembrane domainsFour α-transmembrane helices
    TopologyIntegral inner membrane protein
    Conserved motifsThree conserved motif blocks essential for function
    Homology model templateEmrE transporter (PDB ID: 3b61)
    Prediction toolsTMHMM, TMpred, I-TASSER, AlphaFold

    The four α-transmembrane helical structure is a characteristic signature of members of the SMR superfamily. The predicted 3D structure of YnfA shows similarity to the EmrE transporter, with a coverage of 0.95 and a Normalized Z-score of 2.15, indicating good alignment and threading score .

  • How is YnfA classified within bacterial transporter protein families?

    YnfA is classified as a member of the Small Multidrug Resistance (SMR) superfamily of transporters. Phylogenetic analysis has revealed that YnfA is a distant homolog of other SMR family members and should be considered as a separate subfamily (YnfA family) alongside the three previously known subfamilies .

    This classification is significant because:

    • It establishes YnfA as evolutionarily distinct from other SMR transporters

    • It suggests potentially unique functional properties despite shared structural features

    • It indicates YnfA may have evolved specialized transport capabilities in different bacterial species

    • It provides a framework for understanding related transporters in different organisms

  • What are the recommended storage and handling conditions for recombinant YnfA protein?

    For optimal research outcomes, recombinant YnfA protein requires specific handling protocols:

    ParameterRecommendation
    Long-term storage-20°C/-80°C upon receipt; aliquoting necessary for multiple use
    Working storage4°C for up to one week
    Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
    FormLyophilized powder
    ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
    CryopreservationAdd 5-50% glycerol (final concentration)
    Important noteRepeated freezing and thawing is not recommended

    Prior to opening, it is recommended to briefly centrifuge the vial to bring contents to the bottom. For long-term storage after reconstitution, aliquots should be prepared with glycerol added as a cryoprotectant .

  • Which bacterial species contain YnfA homologs and how conserved is the protein?

    YnfA is relatively widespread among Gram-negative bacteria, particularly among enterobacterial pathogens. Homology analysis reveals:

    Bacterial GenusSimilarity to S. flexneri YnfA
    EscherichiaHigh similarity
    SalmonellaHigh similarity
    CitrobacterHigh similarity
    KlebsiellaHigh similarity
    YersiniaHigh similarity

    Multiple-sequence alignment of these homologs demonstrates that the majority of amino acids are conserved across different Gram-negative bacteria. This high degree of conservation suggests the functional importance of YnfA in these organisms. Phylogenetic analysis indicates that the YnfA protein sequence of S. flexneri closely resembles the YnfA proteins found in these related bacterial species .

  • How does YnfA compare structurally and functionally to other SMR family proteins?

    YnfA shares structural similarities with other SMR family proteins but also exhibits unique characteristics:

    FeatureYnfAOther SMR Proteins (e.g., EmrE)
    Size108 amino acids, 11.9 kDaTypically 100-120 amino acids
    Transmembrane domainsFour α-helicesFour α-helices
    Phylogenetic classificationForms distinct YnfA subfamilyBelong to established SMR subfamilies
    Structural homologySimilar to EmrEVary in substrate specificity
    Conserved motifsThree conserved blocksShare similar conserved motifs
    FunctionEfflux of specific antimicrobialsTransport various substrates

    While YnfA maintains the core structural features of SMR transporters, phylogenetic analysis positions it as a distant homolog of other SMR family members. This suggests that YnfA may have evolved specialized functions while preserving the fundamental transport mechanism characteristic of the SMR superfamily .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.