Recombinant Escherichia coli O8 UPF0114 protein YqhA (yqhA)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Escherichia coli O8 UPF0114 protein YqhA (yqhA) is a protein expressed in E. coli and tagged with N-terminal His for purification and identification . YqhA, also known as UPF0114 protein YqhA, is encoded by the yqhA gene and is involved in the bacterial response to compounds that generate membrane lipid peroxidation . The protein is a full-length E. coli O8 UPF0114 protein YqhA(yqhA) Protein (B7LZF6) consisting of 1-164 amino acids .

Basic Information

CategoryDescription
SynonymsyqhA; ECIAI1_3151; UPF0114 protein YqhA
SourceE. coli
TagHis
Protein LengthFull Length (1-164aa)
AA SequenceMERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
UniProt IDB7LZF6
Molecular WeightApproximately 18.4 kDa (including His tag)
PurityGreater than 90% as determined by SDS-PAGE
FormLyophilized powder
StorageStore at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL; add 5-50% glycerol for long-term storage

Function and Significance

  1. Aldehyde Reductase Activity: E. coli YqhD exhibits aldehyde reductase activity and protects cells against the toxic effect of aldehydes derived from lipid oxidation .

  2. Bacterial Response to Lipid Peroxidation: Overexpression of yqhD results in increased resistance to reactive oxygen species-generating compounds and lipid peroxidation-derived aldehydes .

  3. Protection Against Reactive Oxygen Species: E. coli YqhD is involved in the bacterial response to compounds that generate membrane lipid peroxidation. Overexpression of yqhD increases resistance to hydrogen peroxide, paraquat, chromate, potassium tellurite, and lipid peroxidation-derived aldehydes .

  4. Role in Detoxification: Functions as an aldehyde reductase, reducing toxic aldehydes produced during lipid peroxidation, thereby protecting the cell .

  5. Potential Applications: Understanding the function of YqhA can provide insights into bacterial stress responses and potential targets for antimicrobial strategies . Further research into YqhA homologs in other organisms could reveal conserved mechanisms for aldehyde detoxification and stress response .

Research Findings

  • YqhD overexpression increases resistance to hydrogen peroxide, paraquat, chromate, and potassium tellurite .

  • Increased tolerance was observed for the lipid peroxidation-derived aldehydes butanaldehyde, propanaldehyde, acrolein, and malondialdehyde and the membrane-peroxidizing compound tert-butylhydroperoxide .

  • Expression of yqhD was associated with changes in the concentration of intracellular peroxides and cytoplasmic protein carbonyl content and with a reduction in intracellular acrolein levels .

  • Purified YqhD catalyzes the in vitro reduction of acetaldehyde, malondialdehyde, propanaldehyde, butanaldehyde, and acrolein in a NADPH-dependent reaction .

  • yqhD transcription was induced in cells exposed to conditions favoring lipid peroxidation .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
yqhA; ECIAI1_3151; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
yqhA
Target Protein Sequence
MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant YqhA protein?

For optimal stability, recombinant YqhA should be stored at -20°C or -80°C for extended storage. The protein is typically supplied in a Tris-based buffer with 50% glycerol that has been optimized for protein stability . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing is not recommended as it may compromise protein integrity . The general shelf life of the liquid form is approximately 6 months at -20°C/-80°C, while the lyophilized form can remain stable for up to 12 months at the same temperature range .

What expression systems are most suitable for producing recombinant YqhA?

While YqhA can be expressed in various host systems, E. coli and yeast expression systems offer the best yields and shorter turnaround times for this protein . When higher levels of post-translational modifications are required, expression in insect cells with baculovirus or mammalian cells can be considered, particularly if proper protein folding or retention of biological activity is essential . For standard research applications where basic structural studies are the focus, the E. coli expression system remains the most cost-effective and efficient option .

How can I confirm the purity and identity of recombinant YqhA?

The purity of recombinant YqhA can be assessed using SDS-PAGE, with commercial preparations typically reporting >85% purity . For identity confirmation, several approaches can be employed:

  • Western blotting with antibodies specific to YqhA or to any fusion tags

  • Mass spectrometry for accurate molecular weight determination

  • N-terminal sequencing to verify the protein sequence

  • Comparison with reference standards in databases such as UniProt (Accession numbers: B7LZF6 for E. coli O8, B7NJ05 for E. coli O7:K1, Q0TDA9 for E. coli O6:K15:H31)

For functional verification, specific activity assays would be needed, though these remain limited due to the uncharacterized nature of YqhA's biological function.

What experimental design approaches are most effective for studying YqhA's role in bacterial stress response?

Given the emerging evidence of YqhA's potential role in stress modulation, a comprehensive experimental design should include:

  • Genetic manipulation approaches:

    • Gene knockout studies comparing wild-type and ΔyqhA strains under various stress conditions

    • Site-directed mutagenesis focusing on the W14L mutation known to affect inhibitor tolerance

    • Complementation studies to verify phenotype reversibility

  • Phenotypic characterization:

    • Growth curves under different stress conditions (pH, temperature, inhibitory compounds)

    • Membrane integrity assays to assess the impact on bacterial cell envelope

  • Statistical experimental design:

    • Fractional factorial design (2^8-4) to efficiently test multiple variables simultaneously

    • Variables to consider: growth media composition, induction conditions, stress type and intensity

    • Response variables: growth rate, survival percentage, membrane integrity measures

A systematic approach applied in similar E. coli protein studies achieved high levels (250 mg/L) of soluble expression with 75% homogeneity, which could serve as a benchmark for YqhA expression optimization .

How does the W14L mutation in YqhA contribute to inhibitor tolerance in evolved E. coli strains?

The W14L mutation in YqhA (tryptophan to leucine at position 14) has been observed in adaptively evolved E. coli strains that exhibit enhanced tolerance to lignocellulosic inhibitors . This mutation likely modifies the protein's functional properties in several ways:

  • Structural implications:

    • The mutation site is positioned just before a helical transmembrane region (positions 15-35)

    • The substitution of tryptophan (aromatic, prefers hydrophobic core burial) with leucine (aliphatic, hydrophobic) may alter membrane protein positioning or interaction capabilities

  • Functional hypotheses:

    • Leucine side chains, while non-reactive, play important roles in substrate recognition, particularly for hydrophobic ligands such as lipids, phenols, and furfural

    • This could enhance the cell's ability to bind, recognize, or transport inhibitory compounds

  • Regulatory context:

    • The mutation appears alongside other regulatory mutations (in rssB, basR, and the promoter region of yqhD-dkgA operon) in evolved strains

    • This suggests YqhA functions within a broader stress response network

The table below summarizes the observed mutations in adaptively evolved E. coli strains with enhanced inhibitor tolerance:

StrainGeneProduct descriptionLocationClassNucleotideCodonProtein change
E. coli-LrssBRegulator of σS factor (RpoS)CytoplasmRegulator△T664Frame shiftsL245 → stop
yqhAUPF0114 proteinPlasma membraneRegulator analogG41TTGG → TTGW14L
IGR of yqhC/yqhD5' untranslated region of yqhDCytoplasmRegulator (promoter)T77CAAT → AAC−10 box change
E. coli-HrssBRegulator of σS factor (RpoS)CytoplasmRegulator△T664Frame shiftsL245 → stop
yqhAUPF0114 proteinPlasma membraneRegulator analogG41TTGG → TTGW14L
IGR of yqhC/yqhD5' untranslated region of yqhDCytoplasmRegulator (promoter)T77CAAT → AAC−10 box change
basRTranscription regulatorCytoplasmRegulatorT292CTAT → CATY98H

This data indicates that YqhA's mutation is part of a coordinated evolutionary response to inhibitory conditions, suggesting its role in a regulatory network rather than acting in isolation .

What approaches can be used to elucidate the function of YqhA given its classification as an uncharacterized protein?

Elucidating the function of uncharacterized proteins like YqhA requires a multifaceted approach:

  • Comparative genomics and evolutionary analysis:

    • Phylogenetic profiling to identify co-evolving genes

    • Examination of paralogs like the relationship between YqhA and rsbR in B. subtilis, which suggests a potential role in stress response regulation

    • Analysis of gene neighborhood and operonic organization

  • Structural biology techniques:

    • X-ray crystallography or cryo-EM to determine 3D structure

    • Homology modeling (though previous attempts showed only 48% confidence with the Mrp antiporter complex)

    • Membrane protein topology mapping using cysteine accessibility methods

  • Functional genomics:

    • Transcriptome analysis comparing wild-type and mutant strains under stress conditions

    • Proteomics approaches to identify interaction partners

    • Metabolomics to detect metabolic shifts in response to YqhA manipulation

  • Experimental evolution:

    • Directed evolution experiments similar to the Long-Term Evolution Experiment (LTEE) with E. coli

    • Selection under specific stressors to identify additional adaptive mutations in YqhA

    • Reconstruction of evolutionary trajectories by introducing specific mutations

The existing evidence from adaptively evolved strains suggests YqhA may function as a "regulator analog" within stress response networks, potentially involved in environmental sensing or signal transduction across the membrane .

How can researchers design experiments to investigate potential synergistic effects between YqhA mutations and other genetic changes in evolved E. coli strains?

To investigate potential synergistic effects between YqhA mutations and other genetic changes:

  • Combinatorial genetic reconstruction:

    • Systematically introduce single mutations and combinations into the ancestral background

    • Create a complete set of strains with all possible combinations of the four mutations identified in evolved strains (rssB, yqhA, yqhD-dkgA promoter, basR)

    • Measure fitness effects of individual mutations versus combinations under various stress conditions

  • Epistasis analysis:

    • Calculate expected additive effects of mutations

    • Compare observed fitness of combination strains with expected additive effects

    • Quantify epistatic interactions (positive or negative)

  • Network analysis approaches:

    • Transcriptome comparison across the mutation panel strains

    • Protein-protein interaction mapping

    • Metabolic flux analysis under inhibitory conditions

  • Experimental design considerations:

    • Use factorial experimental design to efficiently test multiple conditions

    • Include appropriate controls (ancestral strain, single mutants)

    • Employ competition experiments to directly measure relative fitness, similar to approaches used in the LTEE

A robust experimental approach would involve creating strains with combinations of mutations using precise genetic engineering techniques, followed by competition experiments against the ancestor and measurement of growth parameters under varied inhibitory conditions. This would allow quantification of both individual and synergistic contributions to inhibitor tolerance.

What methodological considerations are important when optimizing recombinant YqhA expression for structural studies?

Optimizing recombinant YqhA expression for structural studies requires addressing several key considerations:

  • Expression system optimization:

    • Codon optimization for the host organism

    • Selection of appropriate promoter strength to balance expression level with proper folding

    • Evaluation of different E. coli strains (BL21(DE3), K-12 derivatives) for optimal expression

  • Membrane protein-specific considerations:

    • Addition of fusion partners that enhance membrane insertion and folding

    • Testing of specialized E. coli strains like Origami or SHuffle that provide an oxidative cytoplasmic environment

    • Evaluation of detergents for solubilization while maintaining native structure

  • Induction and growth parameters:

    • Factorial design experiments testing:

      • Growth temperature (typically lowered to 16-25°C post-induction)

      • Inducer concentration (e.g., 0.1-1.0 mM IPTG)

      • Cell density at induction (OD600 of 0.6-0.8 often optimal)

      • Media composition (rich vs. minimal, supplementation strategies)

      • Duration of induction (4-16 hours depending on temperature)

  • Purification strategy development:

    • Selection of appropriate affinity tags that don't interfere with structure

    • Development of a multi-step purification protocol

    • Buffer optimization for membrane protein stability

A systematic approach using statistical design of experiments (DoE) as applied in other recombinant protein studies can significantly reduce development time. For example, one study on recombinant protein expression in E. coli used a 2^8-4 fractional factorial design to optimize conditions, resulting in high yields (250 mg/L) of soluble, functional protein .

How can YqhA research contribute to understanding bacterial adaptation to environmental stressors?

YqhA research offers valuable insights into bacterial adaptation mechanisms through several avenues:

  • Stress response network mapping:

    • YqhA appears to function within a regulatory network involving RpoS (via RssB), YqhD-dkgA, and BasR pathways

    • Understanding this network could reveal how bacteria integrate multiple stress signals

  • Membrane-associated stress sensing:

    • As a membrane protein, YqhA may serve as a sensor for environmental stressors

    • The W14L mutation's position near a transmembrane region suggests modification of sensing capabilities

  • Evolutionary mechanisms:

    • YqhA mutations in evolved strains demonstrate how bacteria can rapidly adapt to new environmental pressures

    • The consistent selection of regulatory mutations during adaptation highlights the importance of regulatory networks in evolution

  • Applications to experimental evolution:

    • YqhA could serve as a marker for monitoring adaptation in long-term evolution experiments

    • Knowledge gained could inform directed evolution approaches for creating stress-resistant strains

The Long-Term Evolution Experiment (LTEE) with E. coli has demonstrated how bacteria can evolve over thousands of generations, with regulatory mutations playing key roles in adaptation . YqhA research adds to this understanding by providing specific examples of how membrane protein modifications contribute to stress tolerance.

What are the methodological challenges in determining membrane protein-ligand interactions for YqhA?

Investigating membrane protein-ligand interactions for YqhA presents several methodological challenges:

  • Sample preparation obstacles:

    • Maintaining native-like membrane environment during purification

    • Selecting appropriate detergents or nanodiscs that don't interfere with ligand binding

    • Achieving sufficient protein yield while preserving structure and function

  • Technical limitations of binding assays:

    • Difficulty in distinguishing specific from non-specific binding for hydrophobic ligands

    • Background interference from detergents in spectroscopic methods

    • Limitations in sensitivity for weak interactions

  • Methodological approaches to overcome challenges:

    • Surface plasmon resonance (SPR) with membrane protein immobilization

    • Microscale thermophoresis (MST) for detection of binding in solution

    • Isothermal titration calorimetry (ITC) adapted for membrane proteins

    • Fluorescence-based approaches with labeled ligands or intrinsic tryptophan fluorescence

  • Validating physiological relevance:

    • Correlation of in vitro binding with in vivo phenotypes

    • Mutagenesis of predicted binding sites (including the W14L mutation)

    • Competition assays with potential physiological ligands

A systematic approach would involve initial screening with computational docking of potential ligands (inhibitors, membrane components, signaling molecules), followed by experimental validation using complementary biophysical techniques adapted for membrane proteins.

How might evolutionary insights from YqhA studies inform biotechnological applications?

Evolutionary insights from YqhA studies can inform several biotechnological applications:

  • Strain engineering for industrial processes:

    • The W14L mutation in YqhA, along with other identified mutations, could be introduced into production strains to enhance tolerance to lignocellulosic inhibitors

    • This could improve bioethanol production from plant biomass without expensive detoxification steps

  • Predictive models for evolutionary engineering:

    • Understanding the role of YqhA in adaptation could help predict which mutations might arise in other strains under similar selective pressures

    • This knowledge could accelerate strain development through targeted genetic modifications

  • Biosensor development:

    • If YqhA functions as an environmental sensor, it could potentially be repurposed for detection of specific compounds

    • Modified versions of YqhA could be developed into whole-cell biosensors for environmental monitoring

  • Membrane protein engineering principles:

    • The W14L mutation demonstrates how subtle changes in transmembrane regions can significantly alter cellular phenotypes

    • This principle could be applied to engineer other membrane proteins for enhanced performance

The research on evolved E. coli strains has already shown that "targeting these four regulatory elements revealed by this study could be expected to extend the production yield, titer, and efficiency of various bio-based products like biofuels and chemicals from the undetoxified lignocellulosic hydrolysate or pyrolysate with low cost" .

What experimental design approaches would be most effective for studying the potential role of YqhA in antimicrobial resistance?

Given YqhA's membrane location and potential role in stress response, investigating its contribution to antimicrobial resistance would require:

  • Genetic manipulation and phenotypic characterization:

    • Generation of yqhA knockout, overexpression, and point mutant strains

    • Antimicrobial susceptibility testing using:

      • Broth microdilution method

      • Disk diffusion assays

      • Time-kill curves

    • Analysis across multiple antibiotic classes with different mechanisms of action

  • Factorial experimental design:

    • Testing combinations of:

      • YqhA genetic status (wild-type, knockout, W14L mutation)

      • Antibiotic concentration

      • Growth conditions (pH, temperature, oxygen availability)

      • Presence of other stressors (oxidative stress, membrane-disrupting agents)

  • Mechanistic investigations:

    • Membrane permeability assays (fluorescent dye uptake)

    • Membrane potential measurements

    • Efflux pump activity assessment in YqhA mutants vs. wild-type

  • Evolutionary approaches:

    • Laboratory evolution experiments under antibiotic pressure

    • Monitoring for YqhA mutations in evolving populations

    • Competition experiments between strains with different YqhA alleles under antibiotic stress

This comprehensive approach would help determine whether YqhA plays a direct role in antimicrobial resistance (e.g., by affecting membrane permeability) or an indirect role (e.g., by modulating stress response pathways that contribute to resistance).

What troubleshooting strategies can be employed when recombinant YqhA expression levels are low or the protein is insoluble?

When facing challenges with YqhA expression, several strategies can be implemented:

  • Addressing low expression levels:

    • Optimize codon usage for the host organism

    • Test different promoter systems (T7, tac, araBAD)

    • Evaluate alternative E. coli strains (BL21(DE3), C41/C43 strains specifically designed for membrane proteins)

    • Adjust induction parameters (temperature, inducer concentration, induction timing)

  • Improving protein solubility:

    • Lower post-induction temperature (16-25°C) to slow folding and reduce inclusion body formation

    • Add solubility-enhancing fusion partners (MBP, SUMO, Trx)

    • Include mild detergents in lysis buffer

    • Try specialized E. coli strains like SHuffle® T7 Express that provide an oxidative cytoplasmic environment favorable for proper folding

  • Inclusion body recovery approaches:

    • If refolding is possible, optimize solubilization conditions with different chaotropes

    • Develop a step-wise refolding protocol with gradually decreasing denaturant concentration

    • Include membrane-mimicking environments during refolding (detergents, lipids)

  • Expression optimization matrix:

VariableStandard ConditionsOptimization Options
Growth temperature37°C18°C, 25°C, 30°C
Induction OD6000.6-0.80.4-0.6, 1.0-1.2
IPTG concentration1.0 mM0.1 mM, 0.5 mM
Post-induction time4 hours6 hours, overnight
Media compositionLBTB, 2xYT, auto-induction
AdditivesNoneGlycerol (5-10%), glucose (1 g/L)

Systematic testing of these variables using factorial design approaches has proven successful for optimizing expression of challenging proteins .

How can researchers effectively validate the functional activity of recombinant YqhA given its uncharacterized nature?

Validating the functional activity of an uncharacterized protein like YqhA presents unique challenges. A systematic approach should include:

  • Structural integrity verification:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure

    • Size exclusion chromatography to verify oligomeric state

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to evaluate stability

  • Complementation assays:

    • Rescue experiments in yqhA knockout strains under stress conditions

    • Comparison of W14L mutant vs. wild-type YqhA in complementation efficiency

    • Cross-species complementation testing (e.g., in B. subtilis rsbR mutants)

  • Phenotypic screens:

    • Growth assays under various stressors (inhibitors, pH, temperature)

    • Membrane integrity assays

    • Stress response reporter systems

    • Comparison of evolved strains with reconstructed mutation combinations

  • Molecular interaction studies:

    • Pull-down assays to identify protein interaction partners

    • Bacterial two-hybrid systems

    • Label-free interaction analysis (SPR, BLI)

Without a known biochemical function, validation must rely on comparative phenotypic analysis and the ability of the recombinant protein to rescue defects in knockout strains or reproduce the phenotypic advantages observed in evolved strains with the W14L mutation .

What are the key considerations for designing experiments to study potential interactions between YqhA and other components of bacterial stress response pathways?

Investigating interactions between YqhA and other stress response components requires careful experimental design:

  • Genetic interaction mapping:

    • Synthetic genetic arrays to identify genetic interactions

    • Creation of double/triple mutants combining yqhA mutations with other stress response genes

    • Epistasis analysis to determine pathway positions

  • Physical interaction studies:

    • Co-immunoprecipitation with tagged YqhA

    • Membrane-specific crosslinking approaches

    • Proximity labeling techniques (BioID, APEX) adapted for bacterial systems

    • Split-protein complementation assays

  • Transcriptional network analysis:

    • RNA-seq comparing wild-type, ΔyqhA, and W14L mutant strains under stress

    • ChIP-seq for transcription factors potentially regulated by YqhA

    • Promoter-reporter fusion assays to monitor pathway activation

  • Experimental conditions to consider:

    • Test multiple stress conditions (chemical inhibitors, heat, acid, osmotic)

    • Include time-course experiments to capture dynamic interactions

    • Compare exponential vs. stationary phase responses

    • Consider the role of the membrane environment in mediating interactions

  • Control experiments:

    • Include membrane protein controls unrelated to stress response

    • Use scrambled peptide or non-functional mutant controls

    • Validate interactions using multiple complementary techniques

Since YqhA mutations were found alongside other regulatory mutations (rssB, yqhD-dkgA promoter, basR) in evolved strains , focusing initial interaction studies on these potential pathway components would be a rational starting point.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.