Recombinant Escherichia coli O8 UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Full Length Escherichia coli O8 UPF0208 membrane protein YfbV(yfbV) Protein (B7M5X4) (1-151aa), fused to N-terminal His tag, was expressed in E. coli .

Table 1: Protein Information

CategoryInformation
Cat.No.RFL12572EF
Product OverviewRecombinant Full Length Escherichia coli O8 UPF0208 membrane protein YfbV(yfbV) Protein (B7M5X4) (1-151aa), fused to N-terminal His tag, was expressed in E. coli.
SpeciesE.coli
SourceE.coli
TagHis
Protein LengthFull Length (1-151)
FormLyophilized powder
AA SequenceMSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPVFVENRVIKMTRYAIRFMPPIAVFTLCWQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVLAPVEGKPDYQALADTLKRAFKQLDKTFLDDL
PurityGreater than 90% as determined by SDS-PAGE.
NotesRepeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as a reference.
Gene NameyfbV
SynonymsyfbV; ECIAI1_2369; UPF0208 membrane protein YfbV
UniProt IDB7M5X4

Challenges in Membrane Protein Production

High-level recombinant production of membrane-integrated proteins in Escherichia coli can be challenging . Issues may include the jamming of membrane translocation systems like the Sec-translocon . To address these challenges, tools have been developed to improve membrane protein production, particularly for the common expression host E. coli . Some E. coli mutants were specifically selected to withstand the expression of toxic proteins .

Strategies to Enhance Production

Several strategies can enhance the production of recombinant membrane proteins in E. coli:

  1. Transcriptional Fine-Tuning: Fine-tuning transcription plays a significant role in improving the production of tested proteins . E. coli strains like C41(DE3) and C43(DE3) were found to have improved membrane protein overproduction characteristics .

  2. Codon Optimization: Different codon usage variants can significantly improve the production of some tested proteins .

  3. Optimized E. coli Strains: Certain E. coli strains have been optimized for membrane protein production, including 'Walker strains' E. coli C41(DE3) and C43(DE3), and E. coli LEMO21(DE3) . These strains reduce the high transcription rates from the T7 RNA polymerase (T7RNAP) commonly used in E. coli (DE3) strains to drive recombinant gene expression .

  4. Secretion to Periplasm or Medium: Removing the protein from the cell via secretion to the periplasm or the medium can sometimes be the only way to produce a recombinant protein . This can be achieved through the post-translational Sec-dependent pathway by fusing the recombinant protein to a proper leader peptide . Signal peptides such as Lpp, LamB, MalE, OmpA, OmpC, OmpF, OmpT, PelB, PhoA, PhoE, or SpA can be used for secretion . The co-translational translocation machinery based on the SRP (signal recognition particle) pathway can also be used .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
yfbV; ECIAI1_2369; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
yfbV
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPVFVENRVIKMTRYAIRFMPPIAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YfbV and where is it localized in Escherichia coli?

YfbV is a membrane protein belonging to the UPF0208 family found in Escherichia coli. According to structural and functional analyses, YfbV is primarily localized in the inner membrane of E. coli cells . The protein is encoded by the yfbV gene, which in E. coli K-12 substr. MG1655 spans 456 base pairs and produces a protein of 151 amino acids . YfbV has been alternatively described as a "protein involved in regulation of chromosome structure" in some databases, suggesting its functional role extends beyond typical membrane protein activities .

What is the evolutionary conservation of YfbV across bacterial species?

YfbV belongs to the PF04217 protein family and shows conservation across various E. coli strains, including laboratory K-12 strains and pathogenic variants like O81 (strain ED1a) . Sequence analysis reveals identity clusters at various thresholds (30%, 50%, 70%, 90%, 95%, and 100%), indicating evolutionary conservation with some variability . The protein's consistent presence across different E. coli strains suggests it serves an important cellular function, though comparative genomics studies specifically focusing on YfbV conservation across broader bacterial taxa are still developing.

How does YfbV differ from other membrane proteins in E. coli?

Unlike many other membrane proteins in E. coli that have well-characterized functions in transport, signaling, or enzymatic activities, YfbV serves a relatively unique role in chromosome structure regulation . Specifically, YfbV is involved in insulating the nonstructured regions of the chromosome from the Ter macrodomain . This function distinguishes it from other membrane proteins and places it in a category of proteins that bridge membrane localization with nucleoid organization. While many membrane proteins participate in classical membrane-associated functions, YfbV demonstrates how membrane proteins can influence DNA organization and genome architecture.

What is known about the three-dimensional structure of YfbV?

The three-dimensional structure of YfbV has been computationally modeled using AlphaFold, with the model designated as AF-B7MXH4-F1 for the protein from Escherichia coli ED1a strain . This computational model indicates a confident structure prediction with a global pLDDT (predicted Local Distance Difference Test) score of 81.8, which falls in the "Confident" range (70 < pLDDT ≤ 90) . The model provides insights into the protein's folding pattern and potential functional domains, though it's important to note that "there are no experimental data to verify the accuracy of this computed structure model" . Researchers should interpret the structural features with appropriate caution until experimental validation through techniques like X-ray crystallography or cryo-electron microscopy becomes available.

What membrane topology predictions exist for YfbV?

Membrane topology predictions for YfbV suggest a characteristic transmembrane organization consistent with its inner membrane localization . These predictions indicate potential transmembrane domains that anchor the protein to the bacterial inner membrane while allowing functional domains to interact with either the cytoplasm or periplasm. The specific topology details would be crucial for understanding how YfbV manages to participate in chromosome structure regulation while maintaining its membrane localization. Researchers studying YfbV should consider employing experimental approaches such as cysteine accessibility methods or fluorescent fusion constructs to validate and refine these topology predictions.

What structural domains and motifs characterize YfbV?

YfbV contains structural features characteristic of the UPF0208 membrane protein family (PF04217) . While specific functional domains have not been fully characterized in the search results, the computational structural model suggests regions of varying confidence levels that may correspond to functional elements . The protein's involvement in chromosome structure regulation suggests domains that potentially interact with DNA or DNA-binding proteins. Researchers investigating YfbV should focus on identifying conserved motifs across homologs and correlating structural elements with the protein's reported function in chromosome organization.

What is the primary functional role of YfbV in E. coli?

The primary function of YfbV in E. coli appears to be related to chromosome structure regulation, specifically "insulating the nonstructured regions of the chromosome from the Ter macrodomain" . This function places YfbV in the category of proteins involved in nucleoid organization, which is crucial for proper DNA replication, gene expression, and chromosome segregation during cell division. The mechanism by which a membrane protein like YfbV influences chromosome structure represents an interesting example of membrane-nucleoid interactions in bacteria. Research into this function could reveal important insights into how bacterial cells coordinate different cellular compartments to maintain genomic integrity.

How does YfbV contribute to chromosome structure regulation?

YfbV's role in chromosome structure involves specifically insulating nonstructured regions from the Ter macrodomain . The Ter macrodomain is a region of the bacterial chromosome that contains the replication terminus and has distinct physical properties. YfbV's function suggests it helps maintain proper separation and organization between different chromosomal domains, which is essential for proper chromosome replication and segregation. This function likely involves interactions with other proteins involved in nucleoid organization or direct interactions with DNA. Researchers should consider investigating protein-protein interactions and DNA-binding capabilities to further elucidate this mechanism.

What recombinant expression systems are suitable for YfbV production?

Expression SystemAdvantagesChallengesOptimization Strategies
E. coli BL21(DE3)High yield, simple culturePotential toxicity, inclusion body formationLow temperature induction, fusion tags
C41/C43 strainsAdapted for membrane protein expressionLower yields than standard strainsOptimize induction timing and strength
Cell-free systemsAvoids toxicity issuesHigher cost, lower scalabilitySupplement with lipids or nanodiscs
Yeast systemsBetter for eukaryotic membrane proteinsDifferent membrane compositionCodon optimization for alternative hosts

Researchers should consider starting with E. coli C41/C43 strains specifically developed for membrane protein expression, using moderate induction conditions and including appropriate detergents for protein extraction and purification.

What purification strategies are most effective for membrane proteins like YfbV?

Purifying membrane proteins like YfbV requires specialized approaches to maintain protein stability and function. A methodological purification workflow would include:

  • Membrane isolation: Differential centrifugation to separate inner membrane fractions containing YfbV

  • Solubilization: Testing various detergents (DDM, LDAO, etc.) for optimal YfbV extraction

  • Affinity chromatography: Using a fusion tag (His, FLAG, etc.) for initial capture

  • Size exclusion chromatography: To remove aggregates and achieve higher purity

  • Reconstitution: Transfer into lipid nanodiscs or liposomes for functional studies

The choice of detergent is critical, as it must effectively solubilize YfbV while maintaining its native conformation and function. Researchers should screen multiple detergents and consider amphipols or nanodiscs for downstream applications requiring stable membrane protein samples.

What methods can be used to study YfbV interactions with chromosome regions?

To investigate YfbV's reported role in chromosome structure regulation, researchers could employ several complementary approaches:

MethodInformation ProvidedTechnical Considerations
Chromatin Immunoprecipitation (ChIP)Identifies DNA regions bound by YfbVRequires specific antibodies or tagged YfbV
Chromosome Conformation Capture (3C/Hi-C)Maps long-range chromosomal interactions influenced by YfbVCompares wild-type vs. yfbV mutant strains
Fluorescence microscopyVisualizes YfbV localization relative to nucleoidUses fluorescent protein fusions or immunofluorescence
Bacterial two-hybridIdentifies protein interaction partnersScreens for factors mediating chromosome interactions
In vitro DNA binding assaysTests direct DNA interaction capabilityUses purified YfbV protein

A comprehensive approach would combine these methods to establish whether YfbV interacts directly with DNA or influences chromosome structure through protein intermediaries.

How might YfbV function differ across E. coli pathotypes?

While the search results primarily reference YfbV in laboratory strains (K-12) and the ED1a strain, researchers should consider potential functional variations across different E. coli pathotypes . Pathogenic E. coli strains face different selective pressures and environmental challenges that could influence the function or regulation of chromosome structure proteins like YfbV. Comparative genomic and functional analyses across commensal, extraintestinal pathogenic (ExPEC), and intestinal pathogenic E. coli strains could reveal adaptations in YfbV function related to virulence, stress response, or host adaptation. Researchers should investigate sequence variations, expression patterns, and phenotypic effects of yfbV mutations across diverse E. coli lineages.

What is the relationship between YfbV's membrane localization and its role in chromosome structure?

The dual association of YfbV with both the inner membrane and chromosome structure presents an intriguing research question regarding how these seemingly distinct cellular compartments interact . Advanced research in this area might investigate:

  • Whether YfbV serves as a membrane anchor for the bacterial nucleoid

  • If YfbV participates in transerting - the co-transcriptional and translational insertion of membrane proteins that may influence chromosome positioning

  • How YfbV's membrane topology relates to its accessibility to chromosomal regions

  • Whether environmental signals sensed at the membrane level influence YfbV's interaction with the chromosome

This research direction would contribute to our understanding of the spatial organization of bacterial cells and how different cellular components communicate to coordinate essential functions.

How can computational modeling enhance our understanding of YfbV structure-function relationships?

The availability of a computational structural model of YfbV through AlphaFold represents an opportunity for structure-based functional predictions . Advanced computational approaches could include:

  • Molecular dynamics simulations to model YfbV behavior in membrane environments

  • Docking studies to predict potential interaction partners or DNA binding sites

  • Evolutionary coupling analysis to identify co-evolving residues indicating functional interactions

  • Structure-based prediction of critical residues for mutagenesis studies

These computational approaches should be integrated with experimental validation strategies to develop a comprehensive understanding of YfbV structure-function relationships. For example, predictions of critical functional residues could guide site-directed mutagenesis experiments to test their importance in YfbV's chromosome structuring role.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.