Recombinant Escherichia coli O8 UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Description

Introduction to YciC

Recombinant Escherichia coli O8 UPF0259 membrane protein YciC (yciC) is a conserved bacterial membrane protein encoded by the yciC gene in E. coli strain IAI1 (UniProt ID: B7LY11) . It belongs to the UPF0259 protein family, members of which are implicated in metal ion homeostasis and membrane-associated processes across bacterial species . While functional details of the E. coli YciC remain understudied, homologs like Bacillus subtilis YciC suggest roles as metallochaperones or in zinc trafficking .

Expression Systems

YciC is typically expressed in E. coli host systems using T7 promoter-driven vectors . Key parameters include:

ParameterDetail
Host StrainE. coli BL21(DE3) or derivatives (e.g., C41/C43 for membrane proteins)
TagN-terminal His-tag for affinity chromatography
PurificationNi-NTA resin, followed by size-exclusion chromatography
StorageTris buffer with 50% glycerol; stable at -20°C to -80°C

Functional Insights from Homologs

While direct functional data for E. coli YciC is limited, studies on Bacillus subtilis YciC provide clues:

  • Role in Zinc Homeostasis:

    • Regulated by Zur (zinc uptake regulator) under zinc-sufficient conditions .

    • Postulated to act as a metallochaperone, displacing zinc-containing ribosomal proteins during zinc scarcity .

  • Genetic Regulation:

    • B. subtilis yciC is controlled by two Zur-binding sites (C1 and C2), forming a 9-1-9 inverted repeat for high-affinity Zur interaction .

Applications and Research Utility

  • Antibody Production: Rabbit polyclonal antibodies against YciC are available for immunodetection .

  • Metalloprotein Studies: Used to investigate metal ion trafficking mechanisms in proteoliposome assays .

  • Membrane Protein Folding: Serves as a model for studying co-translational insertion dynamics .

Unresolved Questions and Future Directions

  • Mechanistic Role: Does E. coli YciC function in zinc trafficking or another metal-related pathway?

  • Interactome: Identification of binding partners (e.g., ribosomes, transporters) via pull-down assays.

  • Structural Biology: Cryo-EM or crystallography to resolve full 3D architecture.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery information.
Note: All proteins are shipped standard with blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage state, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
yciC; ECIAI1_1275; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
yciC
Target Protein Sequence
MSITAQSVYRDTGNFFRNQFMTILLVSLLCAFITVVLGHVFSPSDAQLAQLNDGVPVSGS SGLFDLVQNMSPEQQQILLQASAASTFSGLIGNAILAGGVILIIQLVSAGQRVSALRAIG ASAPILPKLFILIFLTTLLVQIGIMLVVVPGIIMAILLALAPVMLVQDKMGIFASMRSSM RLTWANMRLVAPAVLSWLLAKTLLLLFASSFAALTPEIGAVLANTLSNLISAILLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What methods are most effective for recombinant expression and purification of E. coli YciC?

    The recombinant expression of membrane proteins like YciC presents significant challenges due to their hydrophobic nature and potential toxicity. Based on current research, several approaches have proven effective:

    1. Vesicle-packaged expression system: A novel system that exports diverse recombinant proteins in membrane-bound vesicles from E. coli. This approach compartmentalizes proteins within a micro-environment that enables production of otherwise challenging insoluble or toxic proteins. The release of vesicle-packaged proteins supports isolation from the culture and allows long-term storage of active protein .

    2. Peptidisc reconstitution method: This "one-size fits all" membrane mimetic can capture the E. coli cell envelope proteome in water-soluble particles without detergent. The process involves:

      • Brief solubilization with mild detergent

      • Immediate reconstitution into peptidiscs to minimize protein dissociation

      • Fractionation by size exclusion chromatography in detergent-free conditions

    3. Stabilization through protein fusion: A strategy involving fusion of the membrane protein's two termini to a self-assembling coupler protein. This approach includes:

      • Selection of appropriate coupler protein (sfGFP recommended)

      • Generation of fusion constructs using seamless cloning

      • Assessment of membrane folding topology via fluorescence imaging

      • Determination of properly folded protein fraction using differential detergent extraction

    The peptidisc method shows particular promise for YciC as it maintains the native lipid environment and preserves protein-protein interactions better than detergent solubilization or SMA polymer approaches .

  • How can we determine YciC's interaction partners in the zinc transport pathway?

    Identifying YciC's interaction partners requires specialized approaches suitable for membrane proteins. The most effective methodologies include:

    MethodDescriptionAdvantages
    Protein-Correlation-Profiling (PCP)Tracks co-fractionation patterns of proteins across multiple fractionsIdentifies interactions without genetic manipulation under native expression conditions
    SILAC-labeled AP/MSCombines stable isotope labeling with affinity purification and mass spectrometryQuantifies enrichment of interacting proteins and controls for non-specific binding
    Single-molecule photobleachingCounts discrete photobleaching steps in fluorescently labeled proteinsDetects protein associations at extremely dilute concentrations
    FRET analysisMeasures energy transfer between fluorophores in close proximityDirect measure of protein-protein interactions in membrane environment

    The peptidisc workflow has successfully identified over 4900 binary protein interactions from E. coli membrane proteins, validating its effectiveness for studying membrane protein interactions . For YciC specifically, research suggests functional relationships with YciA and YciB in zinc transport, though the physical interactions between these proteins require further characterization .

  • What techniques can be employed to investigate YciC's role in metal ion transport?

    Since YciC is proposed to be part of a novel class of metal ion uptake system, several sophisticated approaches can be applied to elucidate its mechanism:

    1. Metal uptake assays: Measure zinc accumulation in wild-type versus yciC mutant strains using radioactive 65Zn or fluorescent zinc probes

    2. Membrane reconstitution studies: Incorporate purified YciC into proteoliposomes to assess direct transport activity

    3. Electrophysiological techniques: Apply patch-clamp or planar lipid bilayer techniques to measure potential ion conductance through YciC

    4. Directed evolution approaches: Generate YciC variants with altered metal specificities to map functional domains

    5. Protein-correlation-profiling: Identify proteins that co-fractionate with YciC under different metal availability conditions

    6. Reporter gene fusions: Similar to the yciA-lacZ fusion mentioned in the literature, construct reporter fusions to monitor YciC expression under various conditions

    7. Comparative genomics: Analyze YciC homologs across bacterial species to identify conserved functional domains

    These approaches collectively would provide a comprehensive understanding of YciC's role in metal transport and help characterize this potentially novel transport system.

  • What structural characterization methods are most suitable for YciC, and what challenges might researchers encounter?

    Structural characterization of YciC presents several challenges due to its membrane-embedded nature. The following methods offer viable approaches:

    1. X-ray crystallography in lipid cubic phase:

      • Requires purification of YciC under optimized conditions

      • Crystallization in lipid cubic phase

      • Data collection at synchrotron beamlines

      • Major challenge: obtaining sufficient quantities of properly folded protein

    2. Cryo-electron microscopy using vesicle-based methods:

      • Enables structure determination in native lipid environment

      • Bypasses limitations of detergent solubilization

      • Can reveal protein assemblies in their functional state

      • Challenge: achieving sufficient resolution with smaller membrane proteins

    3. Fusion protein approach for stabilization:

      • Fusion of YciC termini to self-assembling coupler protein (e.g., sfGFP)

      • Assessment of proper folding via fluorescence

      • Measurement of thermostability using FSEC

      • Challenge: ensuring the fusion doesn't alter native structure

    4. NMR spectroscopy for dynamics:

      • Suitable for determining membrane topology

      • Can reveal dynamic aspects of function

      • Challenges: size limitations and spectral complexity

    The recent development of vesicle-based methods for membrane protein structure determination offers particular promise, as it maintains proteins in their native lipid environment without requiring detergent screening .

  • How might the function of YciC differ across various E. coli strains and growth conditions?

    Research suggests significant variability in YciC function across E. coli strains and growth conditions:

    1. Strain-specific differences:

      • E. coli O8:H8 strains have been associated with specific virulence factors and may express YciC differently than commensal strains

      • The long-term evolution experiment with E. coli has demonstrated how protein functions can diverge even within the same species over thousands of generations

    2. Growth phase effects:

      • Zur regulation implies that YciC expression varies with zinc availability

      • The timing of protein synthesis induction can significantly affect recombinant protein yield and localization

    3. Metabolic burden considerations:

      • Recombinant expression of membrane proteins like YciC places significant metabolic burden on host cells

      • Proteomics analysis reveals that transcriptional and translational machinery undergoes substantial changes during recombinant protein production

    4. Comparative analysis among strains:

      • Different E. coli host strains (e.g., M15 and DH5α) show significant differences in expression of proteins involved in fatty acid and lipid biosynthesis pathways, which could affect membrane protein insertion and function

      • Pathogenic strains may utilize YciC differently than laboratory strains, particularly under host-imposed zinc limitation

    Understanding these variations is critical for both basic research on YciC function and for optimizing its recombinant expression for structural or functional studies.

  • What is known about the evolutionary conservation of YciC and its homologs across bacterial species?

    YciC represents an interesting case of protein conservation across bacterial species with potential functional diversification:

    1. In E. coli strains:

      • YciC appears in multiple E. coli strains including K-12, ATCC 8739, and UTI89

      • The amino acid sequence is highly conserved among E. coli isolates

    2. Across bacterial genera:

      • Homologs exist in other bacteria, including Bacillus subtilis, where a protein also designated as YciC functions as a Zur-regulated metallochaperone

      • Despite similar regulation by Zur, the functional details may differ between Gram-negative and Gram-positive bacteria

    3. Functional implications:

      • The UPF0259 family designation indicates that the precise function remains uncharacterized, despite conservation

      • The zinc-dependent regulation is maintained across species, suggesting conserved involvement in metal homeostasis

      • Structural features of UPF0259 family members may be conserved even when sequence similarity is moderate

    This conservation pattern suggests that YciC plays an important role in bacterial physiology, particularly in zinc homeostasis, despite variations in the specific mechanisms across different bacterial species.

  • How can systems biology approaches be applied to understand YciC's role in the broader context of E. coli metal homeostasis networks?

    Systems biology offers powerful tools to contextualize YciC within broader metal homeostasis networks:

    1. Integrative multi-omics approaches:

      • Combining transcriptomics, proteomics, and metabolomics data to map changes in response to zinc limitation

      • Identifying regulatory networks that coordinate YciC expression with other zinc-related genes

      • Example methodology: SILAC-labeled proteomics combined with computational network analysis

    2. Mathematical modeling of zinc homeostasis:

      • Developing quantitative models of zinc uptake, storage, and utilization pathways

      • Predicting system-level responses to perturbations in YciC expression or function

      • Simulating the effects of varying zinc concentrations on bacterial growth and metabolism

    3. Protein-protein interaction network mapping:

      • Using peptidisc-based protein correlation profiling to identify the full interactome of YciC

      • Constructing comprehensive maps of interactions between zinc transport proteins

      • Example finding: The peptidisc method has revealed unexpected trans-periplasmic supercomplexes comprising subunits of different membrane machinery

    4. Genome-scale metabolic modeling:

      • Incorporating YciC function into genome-scale models of E. coli metabolism

      • Predicting phenotypic consequences of YciC deletion under various growth conditions

      • Identifying metabolic bottlenecks that emerge when zinc transport is compromised

    These approaches collectively would provide a comprehensive understanding of how YciC contributes to zinc homeostasis and bacterial fitness across diverse environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.