Recombinant Escherichia coli O8 UPF0283 membrane protein ycjF (ycjF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please specify it in your order; we will prioritize your request.
Synonyms
ycjF; ECIAI1_1347; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
ycjF
Target Protein Sequence
MTEPLKPRIDFDGPLEVDQNPKFRAQQTFDENQAQNFAPATLDEAPEEEGQVEAVMDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE TQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is known about the UPF0283 membrane protein ycjF in Escherichia coli?

The ycjF protein in Escherichia coli O8 belongs to the UPF0283 protein family (Uncharacterized Protein Family 0283), indicating that its precise function remains to be fully elucidated. It is characterized as a membrane protein with predicted transmembrane domains, suggesting it localizes to one of E. coli's membrane systems . Like many small membrane proteins in E. coli, ycjF likely contains α-helical transmembrane domains that facilitate its integration into the bacterial membrane structure . The protein is available as a recombinant product for research purposes, enabling investigations into its structure, function, and potential roles in bacterial physiology. Current understanding positions ycjF as one of many membrane proteins that may contribute to E. coli's cellular functions, though specific molecular mechanisms remain subjects of ongoing research.

How is ycjF typically localized within the E. coli membrane system?

While specific localization data for ycjF is limited, research on similar small membrane proteins in E. coli provides insight into its likely localization pattern. Small membrane proteins with predicted α-helical transmembrane domains are generally most abundant in the inner membrane fraction rather than the outer membrane . To determine membrane localization experimentally, researchers typically employ sucrose cushion fractionation protocols that separate inner and outer membranes based on their density differences . The inner membrane of E. coli has lower density than the outer membrane, causing it to "float" on sucrose cushions while the outer membrane sediments through . For a protein like ycjF, investigators would follow cell lysis with differential centrifugation and density-based separation, then use immunoblotting with anti-ycjF antibodies to detect the protein's presence in different fractions. This methodology allows precise determination of whether ycjF resides primarily in the inner membrane, as would be expected for a protein with α-helical transmembrane domains.

What expression systems are most effective for producing recombinant ycjF protein?

The optimal expression system for recombinant ycjF production depends on experimental requirements for protein yield, purity, and native conformation preservation. For membrane proteins like ycjF, E. coli-based expression systems often provide practical advantages due to their simplicity and cost-effectiveness. Expression vectors containing arabinose-inducible promoters (PBAD) have been successfully used for controlled expression of membrane proteins in E. coli . These systems allow fine-tuning of expression levels by varying arabinose concentration, helping prevent toxicity issues often encountered with membrane protein overexpression. For higher yields, T7 promoter-based systems in strains like BL21(DE3) may be employed with careful optimization of induction conditions. When studying protein-protein interactions or requiring more extensive post-translational modifications, alternative systems such as Saccharomyces cerevisiae might be considered. Regardless of the chosen system, incorporating affinity tags (His6, for example) facilitates purification while fusion partners like GFP can assist in monitoring expression and localization .

What are the most reliable methods for determining ycjF membrane topology?

Determining the topology of membrane proteins like ycjF requires multiple complementary approaches to establish the orientation of transmembrane segments and the localization of N- and C-termini. One effective strategy employs topology-reporter fusions, where portions of ycjF are fused to reporter proteins whose activity depends on their cellular compartment localization . For example, fusing alkaline phosphatase (PhoA) or green fluorescent protein (GFP) to different domains of ycjF can indicate whether these regions face the periplasm (PhoA active) or cytoplasm (GFP fluorescent). Accessibility to proteases or chemical modifiers in membrane preparations can also reveal exposed protein regions. Additionally, cysteine scanning mutagenesis combined with membrane-impermeable sulfhydryl reagents helps map domains accessible from either side of the membrane. Importantly, researchers studying small membrane proteins have observed both N-in-C-out and N-out-C-in orientations, with some proteins like ycjF potentially exhibiting dual topology . A comprehensive topology determination should therefore incorporate multiple experimental approaches and consider the possibility of heterogeneous membrane insertion orientations.

How can researchers effectively fractionate and detect ycjF in membrane preparations?

Effective fractionation and detection of ycjF in membrane preparations requires careful separation of cellular components followed by specific identification methods. Begin with bacterial cultures expressing ycjF, preferably with an epitope tag if antibodies against native ycjF are unavailable. After harvesting cells, disruption via sonication or French press in buffer containing protease inhibitors preserves protein integrity. Initial centrifugation at 16,000 × g separates unbroken cells and inclusion bodies from membrane-containing supernatant. Ultracentrifugation at approximately 100,000 × g pellets total membrane fractions. To distinguish between inner and outer membranes, employ sucrose density gradient centrifugation where inner membranes "float" at lower density positions while outer membranes sediment to higher density regions . For detection, Western blotting using antibodies against ycjF or its epitope tag provides specific identification. If studying relative distribution across fractions, ensure samples are properly normalized by total protein content or specific membrane markers. Quantification using imaging software such as ImageJ allows statistical comparison across experimental conditions . Additional verification can be achieved through mass spectrometry analysis of membrane fractions.

What biochemical approaches are used to study interactions between ycjF and other membrane components?

Studying interactions between ycjF and other membrane components requires specialized biochemical approaches that preserve native membrane protein interactions. Cross-linking experiments represent a powerful method, where membrane preparations containing ycjF are treated with bifunctional cross-linking agents that covalently join proteins in close proximity . These complexes can then be analyzed by SDS-PAGE followed by Western blotting or mass spectrometry to identify interaction partners. Co-immunoprecipitation using antibodies against ycjF or potential partner proteins provides another approach to capture interaction complexes. For more stable interactions, blue native PAGE maintains protein complexes during electrophoresis. Genetic approaches like bacterial two-hybrid systems adapted for membrane proteins can complement biochemical methods. Additionally, in vitro translation systems combined with cross-linking have proven valuable for capturing transient interactions during membrane protein insertion, as demonstrated with YidC-dependent proteins . This combination of approaches helps build a comprehensive interaction network, potentially revealing functional relationships between ycjF and other membrane components, insertion machinery, or protein complexes that might suggest cellular roles for this poorly characterized protein.

How do researchers determine whether ycjF utilizes Sec-dependent or YidC-dependent membrane insertion pathways?

Determining the membrane insertion pathway for ycjF requires systematic analysis using both in vivo and in vitro approaches. To assess pathway dependence in vivo, researchers can construct strains with conditional expression of key components of each pathway. For example, strains with arabinose-inducible promoters controlling secE or yidC expression allow controlled depletion of these essential factors . By monitoring ycjF membrane integration under depletion conditions, researchers can identify which pathway components are critical for proper insertion. Complementary in vitro approaches utilize reconstituted systems with purified components. Cell-free translation of ycjF mRNA in the presence of inner membrane vesicles with or without specific pathway components can demonstrate insertion requirements. Cross-linking studies during insertion can capture transient interactions between nascent ycjF and machinery components . Additionally, site-directed mutagenesis targeting potential signal sequences or hydrophobic domains in ycjF, followed by localization analysis, can identify features that direct pathway selection. Research on other small membrane proteins indicates they may use diverse insertion mechanisms, with some requiring only YidC while others depend on SecYEG or utilize both pathways cooperatively , suggesting ycjF might employ pathway-specific or hybrid insertion mechanisms.

What experimental approaches are most effective for analyzing potential dual topology of ycjF protein?

Analyzing potential dual topology of ycjF requires sophisticated experimental approaches that can distinguish between different insertion orientations within the same membrane. A systematic approach begins with computational prediction of transmembrane domains and topology using algorithms like TMHMM or TopPred, examining the distribution of positively charged residues near transmembrane segments (the "positive inside" rule) . Experimentally, dual topology can be investigated using sandwich fusion reporters, where ycjF is flanked by two different reporter domains whose activities depend on their cellular localization (e.g., GFP reporting cytoplasmic exposure and PhoA indicating periplasmic exposure). Quantitative analysis of both reporter activities can reveal proportions of each orientation. Single-molecule approaches like fluorescence microscopy with position-specific labeling can directly visualize topology heterogeneity. Additionally, cysteine accessibility scanning with membrane-impermeable and membrane-permeable sulfhydryl reagents can map domains exposed to different compartments. If ycjF exhibits dual topology like some other small membrane proteins , researchers should investigate whether specific sequence features or cellular conditions influence orientation bias, potentially providing insights into functional significance of this topological heterogeneity.

What approaches can be used to investigate potential functional relationships between ycjF and the YidC-associated membrane protein insertion pathway?

Investigating potential functional relationships between ycjF and the YidC-associated membrane protein insertion pathway requires multifaceted experimental strategies. Genetic approaches provide valuable starting points—constructing strains with conditional expression of YidC (using arabinose-inducible promoters) allows researchers to monitor ycjF membrane integration during YidC depletion . Complementary insertion assays using YidC-depleted membrane vesicles can determine if ycjF insertion efficiency is affected in vitro. Direct interaction studies employing in vivo and in vitro cross-linking can capture physical associations between nascent ycjF and YidC during membrane insertion . Co-purification experiments may reveal stable interactions, while structural studies using techniques like cryo-electron microscopy could visualize insertion intermediates. Functional relationships can also be explored by examining genetic interactions—synthetic growth defects when combining partial ycjF deletion with YidC depletion would suggest pathway overlap. Additionally, researchers should investigate if ycjF shares features with established YidC substrates such as phage coat proteins Pf3 and M13, or E. coli proteins like AtpE that require only YidC for insertion . Examining sequence characteristics, hydrophobicity profiles, and charge distributions might reveal similarities to known YidC-dependent proteins, suggesting mechanistic commonalities in membrane integration.

How can expression profiling and transcriptomic data be used to understand the regulatory context of ycjF?

Expression profiling and transcriptomic approaches provide valuable insights into the regulatory context of ycjF by revealing conditions that influence its expression and potential co-regulated genes. Researchers can employ microarray or RNA-seq analysis to monitor ycjF expression across different growth conditions, stress responses, or genetic backgrounds . Time-course experiments during environmental transitions may reveal temporal patterns in ycjF regulation. Analysis should include proper normalization methods and statistical tests appropriate for the specific platform used, with biological replicates to ensure reliability . Beyond examining ycjF expression in isolation, co-expression network analysis can identify genes with similar expression patterns, potentially revealing functional relationships or shared regulatory mechanisms. The position of ycjF within co-expression modules may suggest biological processes it participates in. Researchers should investigate if ycjF belongs to a specific operon structure by analyzing read coverage across genomic regions and potential co-transcription with neighboring genes. Transcription start site mapping using techniques like 5' RACE can identify promoter regions, while chromatin immunoprecipitation (ChIP) with known transcription factors may reveal direct regulators. Integration of transcriptomic data with proteomics and phenotypic assays provides a more comprehensive understanding of ycjF's role within cellular regulatory networks.

What experimental controls are essential when investigating ycjF insertion mechanisms?

Investigation ApproachEssential ControlsPurpose
In vivo depletion of SecE/YidCImmunoblotting verification of depletion levelsConfirm actual reduction of insertion machinery components
Monitoring known pathway-specific substratesValidate functional consequence of depletion
Cell viability assessmentDistinguish insertion defects from general cellular dysfunction
In vitro insertion assaysMembrane vesicles lacking specific componentsEstablish component requirement
Competition with established substratesDemonstrate specificity of insertion machinery
Protease protection assaysConfirm proper membrane integration
Reporter fusion studiesVerification of fusion protein expression levelsEnsure comparable protein amounts across constructs
Membrane fractionation confirmationVerify membrane targeting of fusion proteins
Reference proteins with known topologyProvide standardization across experiments
Crosslinking experimentsNo-crosslinker controlsIdentify non-specific aggregation
Competition with excess unlabeled proteinDemonstrate binding site specificity
Denaturing conditionsDistinguish specific from non-specific interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.