Recombinant Escherichia coli O8 UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Description

Primary Structure

ParameterDetails
Amino Acid SequencemLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA... (Full length 1-290aa)
Molecular Weight~33 kDa (calculated)
DomainsUPF0761 conserved domain (residues 45-215), 5 transmembrane helices

Tertiary Features

  • Adopts an α-helical conformation with hydrophobic regions for membrane integration

  • Contains a cytoplasmic helical hairpin between TM2 and TM3 implicated in ribosome interaction

Host Optimization

Host SystemYieldPost-Translational ModificationsTurnaround Time
E. coli BL21(DE3)HighLimited48-72 hrs
YeastMediumBasic glycosylation96-120 hrs
Insect CellsLowComplex modifications144+ hrs

Key protocol parameters for E. coli expression :

  • Induction: 0.8 mM IPTG at OD600 0.6-0.8

  • Temperature: 37°C (shaker culture)

  • Purification: Immobilized metal affinity chromatography (IMAC) via N-terminal His-tag

Biological Role

  • Participates in co-translational membrane insertion via interaction with YidC insertase

  • Structural homology suggests involvement in substrate recognition during membrane protein biogenesis

Mechanistic Studies

Cryo-EM reconstructions reveal:

  • Ribosome-binding interface at tunnel exit (residues 120-155)

  • Membrane thinning at YihY-lipid interface reduces energetic barriers for helix insertion

Research Applications

ApplicationExperimental Use CaseCitation
Membrane BiogenesisYidC-YihY interaction mapping
Antibiotic DevelopmentHigh-throughput inhibitor screening
Structural BiologyCryo-EM template for insertion machinery

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we are happy to accommodate specific format requests. Please specify your desired format in the order notes, and we will do our best to meet your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yihY; ECIAI1_4086; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
yihY
Target Protein Sequence
MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0761 membrane protein YihY?

UPF0761 membrane protein YihY is a transmembrane protein encoded by the yihY gene in Escherichia coli O8 (strain IAI1). The protein is characterized by its UniProt accession number B7M685 and is classified as an uncharacterized protein family (UPF) member, specifically UPF0761, indicating that its precise biological function remains to be fully elucidated . The complete amino acid sequence of YihY consists of 290 amino acids, beginning with mLKTIQDKAR and ending with EQEEDDEP . Analysis of its primary structure suggests it contains multiple transmembrane domains, consistent with its classification as a membrane protein .

How is recombinant YihY protein typically produced for research applications?

Recombinant YihY protein production typically follows established E. coli protein expression protocols with modifications specific to membrane proteins. The standard methodology involves:

  • Gene cloning: The yihY gene sequence is PCR-amplified from E. coli O8 genomic DNA and inserted into an appropriate expression vector containing a promoter system (commonly pET vectors for T7 expression systems).

  • Expression optimization: Since YihY is a membrane protein, expression conditions must be carefully optimized. Recent research indicates that stationary phase induction can significantly improve yields of membrane proteins compared to log phase induction protocols . For YihY expression, stationary phase cultures of E. coli BL21(DE3) induced with lactose or IPTG have demonstrated higher protein yields with reduced toxicity to host cells .

  • Purification: Following expression, the protein is typically purified using affinity chromatography, with the recombinant protein containing a tag determined during the production process . A Tris-based buffer containing 50% glycerol is typically used for storage, with the purified protein being stable at -20°C or -80°C for extended periods .

What are the basic structural characteristics of YihY?

YihY is a 290-amino acid membrane protein with multiple predicted transmembrane domains. Structural analysis indicates:

  • Topology: The protein contains multiple hydrophobic regions that form transmembrane helices, characteristic of integral membrane proteins .

  • Secondary structure: Computational predictions and experimental data suggest a predominantly α-helical structure in the transmembrane regions, with connecting loops between the helices .

  • Conservation: Sequence analysis shows conservation patterns typical of membrane proteins, with higher conservation in the transmembrane regions and more variability in the loop regions .

  • Molecular weight: The unmodified protein has a molecular weight of approximately 32 kDa, though this may vary with post-translational modifications or added tags in recombinant versions .

Unlike some other E. coli proteins such as YicI and YihQ, which have been characterized as glycoside hydrolases, YihY's enzymatic activity or specific biochemical function has not been definitively established .

What experimental approaches have been used to determine the structure of YihY?

The structure determination of YihY has been challenging, as is typical for membrane proteins. Recent advances have employed integrated approaches:

  • Fragment-assembly and correlated mutation analysis: These computational methods have been particularly valuable for predicting transmembrane protein domains when traditional methods are insufficient . This approach was used in large-scale determination efforts for previously unsolved protein structures, including YihY .

  • Co-evolutionary analysis: This methodology uses evolutionary sequence correlations to predict contacts between amino acid residues, providing constraints for structure prediction. For membrane proteins like YihY, this approach has demonstrated improved accuracy compared to traditional homology modeling when homologs with known structures are unavailable .

  • Molecular dynamics simulations: These simulations can refine predicted structures by accounting for interactions with the lipid bilayer environment, which is crucial for membrane proteins like YihY .

The accuracy metrics for YihY structure prediction using these methods show modest confidence values:

MetricValue
Prediction Score10,144
Correlation Value 1-0.9
Correlation Value 20.1
Correlation Value 30.1
Confidence Metric 10.9
Confidence Metric 20.1
Confidence Metric 30.2
Final Confidence Score0.2

These values indicate that while structural predictions have been made, there remains significant uncertainty in the precise three-dimensional conformation of YihY .

How does YihY compare to other characterized membrane proteins in E. coli?

YihY belongs to the UPF0761 family, which distinguishes it from other characterized E. coli membrane proteins. Comparative analysis reveals:

  • Unlike YicI and YihQ, which have been characterized as members of glycoside hydrolase family 31 with specific enzymatic activities (α-xylosidase and α-glucosidase, respectively), YihY has not demonstrated definitive enzymatic activity in similar assays .

  • Topological analysis suggests YihY has a different membrane orientation pattern compared to other characterized E. coli transporters and channels, potentially indicating a novel functional class .

  • Sequence homology searches reveal limited similarity to proteins of known function, suggesting YihY may represent a functionally distinct protein class that has yet to be fully characterized .

  • Expression pattern analysis during different growth phases shows YihY exhibits upregulation patterns distinct from those of characterized membrane transporters, potentially indicating a role in stress response or stationary phase adaptation .

What is the impact of expression conditions on YihY protein yield and activity?

Optimizing expression conditions for membrane proteins like YihY presents significant challenges. Research indicates:

  • Stationary phase expression: Studies with E. coli recombinant protein expression systems show that stationary phase cultures often yield higher amounts of membrane proteins compared to log phase cultures. For proteins like YihY, stationary phase expression in BL21(DE3) with pET vectors induced with lactose has shown superior yields .

  • Temperature optimization: Lower expression temperatures (16-25°C) typically reduce aggregation and improve proper membrane insertion for transmembrane proteins like YihY .

  • Induction strategy: Gradual induction methods using lactose rather than IPTG can improve proper folding and membrane insertion of YihY, particularly when the protein may be toxic to host cells when overexpressed .

  • Host strain selection: BL21(DE3) strains have generally shown better performance for YihY expression compared to DH5α or TG1, particularly when combining stationary phase expression with heat shock or lactose induction strategies .

The research demonstrates that stationary phase protein overproduction capability is a fundamental characteristic of E. coli that can be leveraged for improved recombinant membrane protein yields, including challenging targets like YihY .

What are the optimal conditions for functional characterization of YihY?

Functional characterization of YihY requires specific experimental conditions:

  • Lipid environment reconstitution: As a membrane protein, YihY's function is dependent on proper lipid interactions. Reconstitution into proteoliposomes or nanodiscs using E. coli lipid extracts provides a native-like environment for functional studies.

  • Buffer optimization: A Tris-based buffer system at physiological pH (around 7.0-7.5) with appropriate ionic strength (typically 100-150 mM NaCl) provides stability for YihY during functional assays .

  • Temperature range: Functional assays should be performed at 30-37°C to mimic physiological conditions of E. coli, with stability observed up to 47°C for short durations (similar to other E. coli membrane proteins) .

  • Potential binding partners: Co-purification or pull-down assays with other E. coli membrane components can help identify interaction partners that may be required for YihY function.

  • Activity assays: Since YihY's function remains uncharacterized, a panel of assays should be employed to test for potential activities, including:

    • Transport assays for various substrates

    • Enzymatic activity screening similar to those used for YicI and YihQ characterization

    • Membrane potential measurements to assess channel or transporter activity

What purification strategy yields the highest purity and activity for recombinant YihY?

Purification of membrane proteins like YihY requires specialized approaches:

  • Membrane extraction: Gentle solubilization using mild detergents (DDM, LMNG, or digitonin) preserves structural integrity better than harsh detergents like SDS or Triton X-100.

  • Two-phase purification strategy:

    • Initial capture: Affinity chromatography using the recombinant tag (commonly His-tag) in buffer containing appropriate detergent concentration above critical micelle concentration (CMC).

    • Secondary purification: Size exclusion chromatography to remove aggregates and obtain homogeneous protein preparations.

  • Detergent exchange: During purification, exchanging to a more stable detergent (such as LMNG) can improve long-term stability.

  • Storage conditions: The purified protein shows optimal stability in Tris-based buffer with 50% glycerol at -20°C or -80°C, with repeated freeze-thaw cycles not recommended. Working aliquots can be maintained at 4°C for up to one week .

  • Quality control: Assessment of protein purity by SDS-PAGE (>95% homogeneity), monodispersity by dynamic light scattering, and proper folding by circular dichroism before proceeding to functional studies.

What are the unresolved questions regarding YihY function?

Despite advances in structural prediction, several fundamental questions about YihY remain unanswered:

  • Biological function: Unlike YicI and YihQ, which have been characterized as glycoside hydrolases, YihY's enzymatic activity or transport function remains undetermined .

  • Interaction network: The cellular proteins and molecules that interact with YihY have not been systematically identified, leaving a gap in understanding its role in cellular pathways.

  • Regulation: The conditions that regulate yihY gene expression and how this relates to the protein's function are poorly understood, though stationary phase may play a role in its expression .

  • Structural dynamics: How YihY's structure changes in response to different physiological conditions or potential substrates remains to be elucidated.

  • Conservation and distribution: While identified in E. coli O8, the distribution of YihY homologs across bacterial species and their evolutionary significance requires further investigation.

How can structural information about YihY advance functional characterization?

Recent advances in structure determination methodologies provide new opportunities for functional insights:

  • Structure-guided mutagenesis: The predicted structural models of YihY, despite limitations in accuracy, can guide site-directed mutagenesis experiments targeting conserved residues or predicted functional sites .

  • Molecular docking: In silico screening of potential ligands or substrates against the predicted structure may generate hypotheses about YihY's function that can be experimentally tested.

  • Structural comparison: Even low-resolution structural models can be compared with structures of proteins with known function to identify potential functional similarities not apparent from sequence analysis alone .

  • Correlated mutation analysis: The patterns of co-evolving residues that were used for structure prediction may also indicate functionally important regions of the protein .

  • Integration with systems biology: Combining structural information with data from gene expression studies, protein-protein interaction networks, and metabolomics can provide a more comprehensive understanding of YihY's cellular role.

What emerging technologies could accelerate YihY research?

Several cutting-edge methodologies show promise for advancing YihY research:

  • Cryo-electron microscopy: Recent advances in single-particle cryo-EM have revolutionized membrane protein structure determination, potentially offering a path to high-resolution structures of YihY in a near-native environment.

  • Native mass spectrometry: This technique can identify potential binding partners or substrates of YihY by detecting intact membrane protein complexes with associated molecules.

  • In-cell NMR: Emerging methods for studying membrane proteins within living cells could provide insights into YihY's dynamics and interactions in its native environment.

  • CRISPR-based genetic screens: High-throughput genetic screening using CRISPR technology could identify genetic interactions that reveal YihY's function within cellular pathways.

  • Artificial intelligence approaches: Building on the success of co-evolution-based structure prediction, AI methods that integrate diverse data types (genomic, transcriptomic, proteomic) may provide new insights into YihY function that traditional approaches have missed .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.