Recombinant Escherichia coli O8 Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Description

General Information

Escherichia coli (E. coli) is a common bacterium found in the intestines of humans and animals . While most strains are harmless, some can cause disease. E. coli O8 is a specific serogroup of E. coli, and certain strains within this group have been associated with outbreaks of diarrheal diseases .

Zinc transport proteins, such as ZntB, play a crucial role in maintaining zinc homeostasis within the bacterial cell. Zinc is an essential micronutrient involved in various cellular processes, but excessive amounts can be toxic. ZntB helps regulate zinc levels by facilitating its transport across the cell membrane.

Recombinant protein production involves using genetically engineered organisms to produce specific proteins of interest . This technology is widely used in biotechnology and pharmaceutical research for producing proteins for various applications, including drug development and structural biology.

Protein Information

The ZntB protein is a zinc transporter in E. coli O8, encoded by the zntB gene. The protein sequence of Recombinant Escherichia coli O8 Zinc transport protein ZntB(zntB) consists of 327 amino acids . The amino acid sequence is: MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHESAQWLATTPLLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTRQRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQIPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDEIDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQFGFSIFCILLVVLIGGVALWLHRSKWL . ZntB facilitates the movement of zinc ions across the cell membrane, contributing to zinc homeostasis.

Role in Virulence and Pathogenesis

While ZntB is primarily involved in zinc homeostasis, its role in bacterial virulence and pathogenesis can be complex. Zinc availability can influence the expression of virulence factors and the ability of bacteria to cause infection. Studies suggest Shiga toxin-producing Escherichia coli (STEC) can cause diseases ranging from mild diarrhea to fatal extra-intestinal hemolytic uremic syndrome (HUS) . Further research is needed to fully elucidate the role of ZntB in the context of E. coli O8 virulence.

Research and Outbreaks

E. coli O8 strains have been implicated in outbreaks of diarrheal diseases. Some E. coli O8:H8 strains carry a prophage-encoded gene for a novel heat-labile enterotoxin LT2 variant (LT2d) and colonization factor antigen III (CFA/III) . A study identified two outbreaks of diarrhea caused by closely related E. coli O8:H8 strains carrying a gene for LT2d and the genes for CFA/III . These findings highlight the importance of monitoring infections caused by E. coli strains producing LT2d with colonization factors .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
zntB; ECIAI1_1371; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHESAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL
Uniprot No.

Target Background

Function
Mediates the efflux of zinc ions.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the current understanding of ZntB's function in Escherichia coli?

Contrary to earlier assumptions, recent research has established that ZntB functions primarily as a zinc uptake transporter rather than an exporter. Cryo-electron microscopy studies of the full-length ZntB from Escherichia coli, combined with isothermal titration calorimetry and transport assays using ZntB reconstituted into liposomes, have demonstrated that ZntB mediates Zn²⁺ uptake . This uptake mechanism is stimulated by a pH gradient across the membrane and employs a transport mechanism distinct from the one proposed for its homologous protein, CorA channels . This represents a significant shift in our understanding of zinc homeostasis in bacterial systems, particularly in Enterobacteriaceae where several membrane transporters contribute to maintaining proper zinc balance.

How does ZntB compare structurally and functionally to other zinc transporters in E. coli?

E. coli employs multiple zinc transport systems with distinct characteristics:

TransporterFamilyEnergy SourceSpecificityRelative Efficiency
ZntB-pH gradientZn²⁺Intermediate
ZnuACBC9 cluster of ABC transportersATP hydrolysisZn²⁺ specificHigh (predominant)
ZupTZIP familyChemo-osmotic gradientZn²⁺, Mn²⁺, Fe²⁺Lower than ZnuACB
SitABCDC9 cluster of ABC transportersATP hydrolysisZn²⁺, Mn²⁺Minimal contribution

ZnuACB has been demonstrated to be the predominant zinc transport system in E. coli, particularly in uropathogenic strains. In uptake studies with UPEC strain CFT073, loss of the Znu system resulted in the greatest decrease in ⁶⁵Zn²⁺ accumulation, while loss of the ZupT system had a less marked effect . The higher zinc affinity of ZnuACB is likely due to its ZnuA periplasmic ligand binding protein, which contains specialized metal-binding histidine residues . ZntB represents an important alternative transport system that has distinct structural and mechanistic properties from these other transporters.

What experimental approaches are recommended for studying ZntB expression and regulation?

For comprehensive investigation of ZntB expression and regulation, researchers should implement a multi-faceted approach:

  • Transcriptional analysis: Quantitative RT-PCR to measure zntB mRNA levels under varying zinc concentrations and environmental conditions.

  • Protein detection: Western blot analysis using specific antibodies like polyclonal rabbit anti-ZntB (similar to CSB-PA485109XA01EOO), which can be used in both ELISA and Western blot applications .

  • Reporter systems: Construction of zntB promoter-reporter fusions (e.g., lacZ, GFP) to monitor expression in response to different stimuli.

  • Mutant analysis: Creation and characterization of deletion mutants (ΔzntB) and comparison with other zinc transporter mutants (Δznu, ΔzupT) to assess relative contributions to zinc homeostasis.

  • Transport assays: Radioactive ⁶⁵Zn²⁺ uptake experiments using purified protein reconstituted into liposomes or intact cells with varying pH gradients to assess transport activity and directionality .

The antibody approach requires careful consideration of storage conditions (-20°C or -80°C, avoiding repeated freezing), buffer components (50% glycerol, 0.01M PBS, pH 7.4), and proper purification methods (antigen affinity purification) .

How does pH gradient influence ZntB-mediated zinc transport mechanisms?

The pH gradient across the bacterial membrane plays a critical role in driving ZntB-mediated zinc transport. Experimental evidence from cryo-electron microscopy and functional assays demonstrates that ZntB-mediated Zn²⁺ uptake is stimulated by this pH gradient . This finding represents a significant departure from the transport mechanism proposed for the homologous CorA magnesium channels.

For researchers investigating this phenomenon, the recommended methodological approach includes:

  • Liposome reconstitution assays: Purify ZntB protein and reconstitute it into liposomes with defined internal pH values. Establish various pH gradients across the liposomal membrane and measure ⁶⁵Zn²⁺ uptake rates under each condition.

  • Site-directed mutagenesis: Identify and mutate key residues potentially involved in proton coupling to determine the molecular basis of pH-dependent transport.

  • Fluorescent pH indicators: Incorporate pH-sensitive fluorescent dyes into liposomes containing ZntB to simultaneously monitor pH changes and zinc transport.

  • Electrophysiology: Perform patch-clamp experiments on giant liposomes or bacterial spheroplasts expressing ZntB to measure transport currents under varying pH conditions.

This pH-dependence suggests that ZntB may function as a proton-coupled zinc transporter, where the energy of the proton gradient is harnessed to drive zinc uptake against its concentration gradient, a mechanism distinct from that of CorA channels .

What are the experimental considerations for resolving contradictions in ZntB transport directionality?

The revised understanding that ZntB functions in zinc uptake rather than export presents an important case study in resolving contradictions in membrane transport research. To address similar contradictions, researchers should consider:

  • Bidirectional assays: Implement assays capable of measuring transport in both directions using radioisotopes like ⁶⁵Zn²⁺. Compare rates under varying conditions of internal and external zinc concentrations.

  • Genetic complementation studies: In a system lacking all known zinc transporters (e.g., E. coli K-12 Δznu ΔzupT strain), express ZntB from a controlled promoter and assess its ability to restore growth in zinc-limited medium .

  • Fluorescent zinc indicators: Utilize selective zinc-binding fluorophores to monitor real-time changes in intracellular and extracellular zinc concentrations in response to ZntB activity.

  • Thermodynamic analysis: Employ isothermal titration calorimetry to determine binding affinities and energetics of zinc interaction with ZntB under varying pH conditions .

  • Structural comparisons: Perform detailed structural analysis of ZntB in comparison to known importers and exporters to identify hallmark features of transport directionality.

The contradictions regarding ZntB transport direction highlight the importance of direct functional assays rather than relying solely on homology-based predictions, as the mechanism of ZntB differs significantly from that of its structural homologue CorA .

How can cryo-electron microscopy be optimized for studying ZntB structural conformations?

Cryo-electron microscopy (cryo-EM) has been instrumental in elucidating the full-length structure of ZntB from Escherichia coli . For researchers planning to use this technique to investigate ZntB or similar transporters, the following optimizations are recommended:

  • Sample preparation:

    • Purify ZntB to >95% homogeneity using affinity chromatography followed by size exclusion chromatography

    • Optimize detergent selection for membrane protein extraction (typically n-dodecyl-β-D-maltoside or lauryl maltose neopentyl glycol)

    • Test multiple buffer conditions to identify those that maintain protein stability and prevent aggregation

  • Grid optimization:

    • Use quantifoil R1.2/1.3 grids with continuous carbon support

    • Optimize blotting times (typically 4-6 seconds) and temperature (4°C)

    • Apply multiple freeze-plunge protocols to identify optimal vitrification conditions

  • Data collection strategies:

    • Implement aberration-corrected imaging with energy filters

    • Use beam-tilt data collection for higher-resolution structural determination

    • Apply dose fractionation (20-40 frames per exposure) with total dose limitation to minimize radiation damage

  • Conformational capture:

    • Trap different functional states by adding zinc, magnesium, or other divalent cations at varying concentrations

    • Stabilize conformations using nanobodies or conformation-specific antibodies

    • Apply pH gradients in proteoliposomes before vitrification to capture transport-relevant states

These optimizations can help reveal the molecular mechanism of ZntB-mediated zinc transport and structural changes associated with pH-dependent activation.

What methodological approaches are recommended for analyzing ZntB contribution to bacterial virulence?

Understanding ZntB's role in bacterial virulence requires sophisticated experimental approaches that link zinc transport to pathogenicity. Based on studies of related zinc transport systems, the following methodologies are recommended:

  • Animal infection models:

    • Develop competitive infection models comparing wild-type and ΔzntB mutants, similar to the approach used for studying Znu and ZupT transporters in urinary tract infections

    • Quantify bacterial burden in relevant tissues

    • Evaluate host immune responses, particularly those related to nutritional immunity

  • Oxidative stress resistance assays:

    • Measure survival rates of wild-type and ΔzntB mutants when exposed to hydrogen peroxide or other oxidative stressors

    • Determine if zinc supplementation can rescue oxidative stress sensitivity phenotypes

    • Analyze expression of oxidative stress response genes in the absence of ZntB

  • Motility and biofilm formation:

    • Assess swimming and swarming motility on semi-solid agar plates

    • Quantify biofilm formation using crystal violet staining or confocal microscopy

    • Investigate zinc-dependent regulation of flagellar genes

  • Transcriptomic and proteomic analysis:

    • Perform RNA-Seq or microarray analysis comparing wild-type and ΔzntB strains under infection-relevant conditions

    • Use mass spectrometry-based proteomics to identify changes in protein abundance

    • Identify virulence factors whose expression is altered by zinc availability

Studies with other zinc transporters have shown that zinc acquisition systems can significantly impact bacterial fitness during infections. For example, in uropathogenic E. coli CFT073, Δznu and Δznu ΔzupT strains demonstrated significantly reduced colonization in bladders and kidneys during urinary tract infections . The loss of zinc transport systems also decreased both motility and resistance to hydrogen peroxide, which could be restored by supplementation with zinc .

What are the recommended protocols for measuring ZntB-mediated zinc transport in reconstituted systems?

For accurate measurement of ZntB-mediated zinc transport in reconstituted systems, researchers should implement the following protocol:

  • Protein purification and reconstitution:

    • Express recombinant ZntB with appropriate tags (His-tag recommended)

    • Purify using affinity chromatography followed by size exclusion chromatography

    • Reconstitute into liposomes composed of E. coli total lipid extract or defined phospholipid mixtures (typically 3:1 POPE:POPG)

    • Verify protein orientation using protease protection assays

  • Radioisotope uptake assays:

    • Prepare liposomes with defined internal buffer (typically pH 7.4)

    • Establish external buffer conditions with varying pH (6.0-8.0) to create pH gradients

    • Add ⁶⁵Zn²⁺ (typically 0.1-10 μM) to external buffer

    • Incubate for defined time periods (15 seconds to 30 minutes)

    • Terminate transport by rapid filtration or gel filtration

    • Quantify internalized ⁶⁵Zn²⁺ using liquid scintillation counting

  • Fluorescent assays:

    • Incorporate zinc-sensitive fluorophores (FluoZin-3, Newport Green) inside liposomes

    • Monitor fluorescence changes in real-time using a spectrofluorometer

    • Calibrate signals using ionophores to establish maximum and minimum signals

  • Controls and validation:

    • Include protein-free liposomes as negative controls

    • Use ionophores (A23187) with zinc to establish maximum transport rates

    • Test transport inhibition using divalent cation chelators (EDTA)

    • Verify zinc specificity by competition with other divalent cations

  • Data analysis:

    • Calculate initial transport rates from linear phase of uptake

    • Determine kinetic parameters (Km, Vmax) using varying zinc concentrations

    • Assess pH dependence by plotting transport rates against ΔpH

These methodologies have been successfully employed to demonstrate that ZntB mediates Zn²⁺ uptake stimulated by a pH gradient across the membrane .

How do ZntB, ZnuACB, and ZupT systems interact in maintaining zinc homeostasis?

Zinc homeostasis in E. coli is maintained through the coordinated activity of multiple transport systems. Their relative contributions and interactions can be summarized as follows:

AspectZntBZnuACBZupT
Primary functionZn²⁺ uptakeZn²⁺ uptakeZn²⁺ uptake
Relative contributionIntermediatePredominantMinor
RegulationUnknown/pH responsiveZur-regulatedUnknown
EnergeticspH gradient-dependentATP-dependentChemo-osmotic gradient
Impact on virulenceNot directly establishedSignificant (4.4-fold reduction in bladder, 41-fold in kidneys)Limited alone, cumulative with Znu (30-fold reduction in bladder, 48-fold in kidneys)

The functional relationship between these systems has been investigated through studies of single and double mutants. In uropathogenic E. coli CFT073, the Δznu strain demonstrated an intermediate decrease in ⁶⁵Zn²⁺ uptake and growth in minimal medium, whereas the ΔzupT mutant grew as well as wild-type CFT073 and exhibited a less marked decrease in ⁶⁵Zn²⁺ uptake . The double mutant Δznu ΔzupT showed a more severe phenotype, demonstrating decreased ⁶⁵Zn²⁺ uptake and growth in minimal medium .

Complementation studies have shown that the znuACB genes can restore growth in Zn-deficient medium and bacterial numbers in the bladder and kidneys for a Δznu ΔzupT double mutant . This suggests a hierarchy where ZnuACB functions as the primary zinc acquisition system, with ZupT serving as a secondary system, while ZntB likely plays an intermediate role that may become more significant under specific environmental conditions.

What are the methodological considerations for studying zinc transporter specificity?

Determining the specificity and relative importance of zinc transporters requires careful experimental design. The following methodological considerations are essential:

  • Genetic approaches:

    • Create single, double, and triple deletion mutants (e.g., Δznu, ΔzupT, ΔzntB, Δznu ΔzupT, Δznu ΔzntB, etc.)

    • Complement mutants with plasmid-expressed transporters under controlled promoters

    • Use site-directed mutagenesis to modify metal-binding residues to alter specificity

  • Transport assays:

    • Measure uptake of ⁶⁵Zn²⁺ in various genetic backgrounds

    • Perform competition assays with other divalent cations (Mg²⁺, Mn²⁺, Fe²⁺, Cu²⁺)

    • Compare transport rates under varying metal concentrations to determine affinity

  • Growth phenotype analysis:

    • Evaluate growth in defined minimal media with controlled zinc concentrations

    • Test growth rescue by zinc supplementation versus other metals

    • Assess growth under various environmental stresses (oxidative stress, pH extremes)

  • Metal content determination:

    • Use inductively coupled plasma mass spectrometry (ICP-MS) to quantify intracellular zinc content

    • Compare metal profiles across different transporter mutants

    • Monitor zinc distribution across subcellular fractions

In previous studies, complementation experiments with the E. coli K-12 Δznu ΔzupT strain QT1435 have been particularly informative. Plasmids encoding either Znu (pIJ156) or ZupT (pIJ202) conferred increased uptake of ⁶⁵Zn²⁺, while SitABCD provided only a slight improvement in zinc uptake . These approaches revealed that despite ZupT's ability to transport zinc when expressed from a medium-copy-number plasmid, it is less efficient than the ZnuACB transporter when expressed at wild-type levels .

What are the promising approaches for investigating ZntB regulation at the molecular level?

Understanding the molecular regulation of ZntB expression and activity represents an important frontier in zinc transport research. Based on current knowledge gaps, the following approaches are recommended:

  • Transcriptional regulation:

    • Perform chromatin immunoprecipitation sequencing (ChIP-seq) to identify transcription factors binding to the zntB promoter

    • Use electrophoretic mobility shift assays (EMSA) to validate specific DNA-protein interactions

    • Create promoter truncations and site-directed mutations to map regulatory elements

  • Post-translational modifications:

    • Apply mass spectrometry-based phosphoproteomics to identify potential regulatory modifications

    • Generate phosphomimetic and phosphodeficient variants to assess functional consequences

    • Identify kinases and phosphatases that may regulate ZntB activity

  • Protein-protein interactions:

    • Implement bacterial two-hybrid or pull-down assays to identify ZntB-interacting proteins

    • Verify interactions using fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC)

    • Determine if interactions are zinc-dependent or influenced by other environmental factors

  • Structural dynamics:

    • Use hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions undergoing conformational changes upon zinc binding or pH shifts

    • Apply single-molecule FRET to monitor real-time conformational changes

    • Develop conformation-specific antibodies to trap and study different functional states

These approaches would fill significant knowledge gaps in our understanding of how bacteria coordinate the expression and activity of different zinc transporters in response to changing environmental conditions and zinc availability.

How can advanced imaging techniques enhance our understanding of ZntB localization and dynamics?

Advanced imaging techniques offer powerful approaches to investigate the subcellular localization, organization, and dynamics of ZntB in bacterial cells. The following methodologies represent promising avenues for future research:

  • Super-resolution microscopy:

    • Implement PALM (Photoactivated Localization Microscopy) or STORM (Stochastic Optical Reconstruction Microscopy) to visualize ZntB distribution with nanometer precision

    • Use dual-color super-resolution imaging to examine co-localization with other zinc transporters or regulatory proteins

    • Analyze clustering and oligomerization states under varying zinc conditions

  • Single-particle tracking:

    • Create fluorescent protein fusions or use antibody-conjugated quantum dots to track individual ZntB molecules

    • Measure diffusion coefficients and confined zones to determine if ZntB localizes to specific membrane domains

    • Assess how zinc availability affects ZntB mobility

  • Correlative light and electron microscopy (CLEM):

    • Combine fluorescence imaging with high-resolution electron microscopy to correlate ZntB localization with ultrastructural features

    • Implement cryo-CLEM to visualize ZntB in its native environment with minimal artifacts

  • Förster resonance energy transfer (FRET):

    • Develop intramolecular FRET sensors to monitor ZntB conformational changes in response to zinc or pH

    • Use intermolecular FRET to study interactions with other components of zinc homeostasis machinery

  • Expansion microscopy:

    • Apply physical expansion of bacterial cells to achieve super-resolution with conventional microscopes

    • Combine with multiplexed antibody staining to visualize ZntB in relation to multiple cellular components

These imaging approaches would provide unprecedented insights into how ZntB contributes to zinc homeostasis in the context of the bacterial cell envelope and how its distribution and dynamics respond to changing environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.