Recombinant Escherichia coli O8 Zinc transporter ZupT (zupT)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

The recombinant Escherichia coli O8 zinc transporter ZupT (zupT) is a bacterial membrane protein encoded by the zupT gene. It belongs to the ZIP (Zrt, Irt-like Protein) family of divalent metal ion transporters, primarily facilitating zinc (Zn²⁺) uptake. ZupT was first characterized in E. coli K-12 and later identified in pathogenic strains like UPEC (uropathogenic E. coli) CFT073 . The recombinant form is produced via heterologous expression in E. coli O8 strain IAI1, enabling structural and functional studies .

PropertyDetail
GenezupT (formerly ygiE)
Protein Length257 amino acids (strain IAI1)
FunctionZn²⁺, Mn²⁺, Fe²⁺ transport; ATP-independent, chemo-osmotic gradient-dependent
Structural FeaturesMultiple transmembrane domains; histidine-rich regions for metal binding

Functional Mechanisms and Substrate Specificity

ZupT operates as a broad-spectrum divalent metal transporter with distinct substrate preferences:

Metal IonUptake EfficiencyRole in E. coli
Zn²⁺HighPrimary zinc acquisition
Fe²⁺ModerateIron uptake in chelator-treated cells
Mn²⁺ModerateManganese transport; hypersensitivity risk

Key Findings:

  • Zn²⁺ Transport: ZupT complements Zn-uptake defects in znuACB-deficient E. coli, though ZnuACB is the predominant Zn transporter .

  • Iron and Manganese: Facilitates Fe²⁺ and Mn²⁺ uptake, but with lower affinity than dedicated systems (e.g., FeoABC, MntH) .

  • Oxidative Stress Sensitivity: Overexpression increases Co²⁺ hypersensitivity, while loss reduces motility and H₂O₂ resistance in UPEC .

Role in Pathogenicity and Infection

In extraintestinal pathogenic E. coli (ExPEC), ZupT contributes to virulence during urinary tract infections (UTIs):

Pathogenic StrainImpact of ZupT LossExperimental Evidence
UPEC CFT073Reduced kidney colonization; impaired motilityMurine UTI models
General E. coliGrowth defects in Zn-limited environmentsIn vitro growth assays

Mechanistic Insights:

  • Zn Homeostasis: Zinc is essential for FlhC (flagellar regulator) and Fur (iron homeostasis) function, linking ZupT to motility and oxidative stress resistance .

  • Synergy with ZnuACB: Dual loss of Znu and ZupT exacerbates UTI defects, indicating additive roles in zinc acquisition .

Research Applications and Significance

The recombinant ZupT protein is critical for:

  1. Biochemical Assays: Studying metal selectivity and transport kinetics .

  2. Structural Biology: X-ray crystallography or cryo-EM to resolve ZIP transporter mechanisms .

  3. Antimicrobial Development: Targeting Zn transporters in pathogenic E. coli .

Limitations:

  • Regulation: Unlike ZnuACB (Fur-regulated), ZupT lacks known transcriptional regulation .

  • Pathogenic Strain Variability: ZupT’s contribution differs between E. coli K-12 and UPEC strains .

Comparative Analysis with Other Transporters

TransporterFamilySubstratesEnergy SourcePrimary Role
ZupTZIPZn²⁺, Fe²⁺, Mn²⁺Chemo-osmoticSecondary Zn uptake
ZnuACBABC (C9 cluster)Zn²⁺, Cd²⁺ATP hydrolysisPrimary Zn uptake
SitABCDABC (C9 cluster)Mn²⁺, Fe²⁺, Zn²⁺ATP hydrolysisManganese uptake

Key Distinctions:

  • ZnuACB vs. ZupT: ZnuACB has higher Zn²⁺ affinity due to its periplasmic binding protein (ZnuA) .

  • ZupT vs. SitABCD: ZupT transports Zn²⁺ more efficiently than SitABCD in E. coli K-12 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notification and additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
zupT; ECIAI1_3187; Zinc transporter ZupT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Escherichia coli O8 (strain IAI1)
Target Names
zupT
Target Protein Sequence
MSVPLILTILAGAATFIGAFLGVLGQKPSNRLLAFSLGFAAGIMLLISLMEMLPAALAAE GMSPVLGYGMFIFGLLGYFGLDRMLPHAHPQDLMQKSVQPLPKSIKRTAILLTLGISLHN FPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAILWAGISGLA EILGGVLAWLILGSMISPVVMAAIMAAVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCG MSVMGFSLVLLQTAGIG
Uniprot No.

Target Background

Function

Mediates zinc uptake and may also transport other divalent cations.

Database Links
Protein Families
ZIP transporter (TC 2.A.5) family, ZupT subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ZupT and what is its role in E. coli zinc homeostasis?

ZupT is a member of the ZIP (ZRT/IRT-like protein) family of transporters found in both prokaryotes and eukaryotes . Unlike the ATP-dependent ZnuACB transporter, ZupT utilizes a chemiosmotic transmembrane gradient to transport zinc across the bacterial membrane . ZupT has broader specificity than ZnuACB, capable of mediating the uptake of not only Zn²⁺ but also Co²⁺, Fe²⁺, and Mn²⁺ .

While the ZnuACB system functions as the primary high-affinity zinc transporter in E. coli, ZupT serves as a secondary zinc transport system that helps maintain zinc homeostasis, particularly in conditions where zinc availability is limited . In wild-type E. coli, ZupT contributes to zinc uptake, but its loss alone typically has less impact on growth and zinc acquisition than loss of the ZnuACB system .

How does ZupT compare structurally and functionally to other zinc transporters in E. coli?

E. coli possesses two major zinc transport systems with distinct structural and functional properties:

TransporterFamilyEnergy SourceMetal SpecificityRelative EfficiencyStructural Features
ZupTZIP (ZRT/IRT-like protein)Chemiosmotic gradientZn²⁺, Co²⁺, Fe²⁺, Mn²⁺Secondary importanceMembrane protein without periplasmic component
ZnuACBCluster C9 (TroA-like) ABC transportersATP hydrolysisHighly specific for Zn²⁺Primary zinc transporterContains ZnuA periplasmic binding protein with histidine-rich loop and high-affinity Zn²⁺-binding pocket
SitABCDCluster C9 ABC transportersATP hydrolysisPrimarily Mn²⁺ and Fe²⁺, minimal Zn²⁺Minimal contribution to zinc uptakeSimilar to TroA, can bind zinc but limited transport into cytoplasm

The higher zinc affinity of ZnuACB is attributed to its ZnuA periplasmic binding protein, which contains both a metal-binding histidine-rich loop and a high-affinity Zn²⁺-binding pocket within the protein . When expressed at wild-type levels, ZupT demonstrates less efficient zinc transport compared to ZnuACB in uropathogenic E. coli strain CFT073 .

What experimental approaches are used to measure zinc transport activity in E. coli?

Several experimental approaches can be used to assess zinc transport activity in E. coli, with the following being particularly informative:

  • Isotope uptake assays: The accumulation of radioactive ⁶⁵Zn²⁺ by bacterial cells provides a direct measure of zinc transport activity. In this approach, bacterial cells are typically grown in zinc-deficient conditions, then exposed to ⁶⁵Zn²⁺ for a defined period before washing to remove unbound isotope and measuring radioactivity . This method allows direct quantification of zinc uptake in pmol/10⁸ cells.

  • Growth assays in zinc-limited media: Bacteria are cultured in media where zinc availability is restricted using chelators such as EDTA or EGTA. Growth curves or endpoint measurements provide indirect evidence of zinc transport efficiency . The degree of growth inhibition correlates with the strain's ability to acquire zinc under limiting conditions.

  • Complementation studies: Plasmid-based expression of zinc transporters in zinc transport-deficient mutants allows assessment of the ability of specific transporters to restore zinc uptake and growth . This approach is useful for comparing the functional characteristics of different transport systems.

How do mutations in zupT affect E. coli growth in zinc-limited conditions?

The impact of zupT mutations on E. coli growth in zinc-limited conditions depends on the genetic background and the presence of other zinc transport systems. Experimental data reveals:

In E. coli K-12:

  • Single ΔzupT mutants exhibit only minor growth defects in zinc-limited media

  • ΔznuACB ΔzupT double mutants show severe growth impairment in zinc-limited conditions, much more pronounced than ΔznuACB single mutants

In uropathogenic E. coli strain CFT073:

  • ΔzupT mutants grow similarly to wild-type in zinc-limited media

  • ΔznuACB mutants show intermediate growth defects

  • ΔznuACB ΔzupT double mutants display the most severe growth impairment

These observations indicate that while ZupT plays a secondary role in zinc acquisition, its contribution becomes critical when the primary ZnuACB transporter is absent. The complementation of ΔznuACB ΔzupT mutants with plasmid-expressed ZupT restores growth in zinc-deficient conditions, confirming ZupT's direct role in zinc transport .

Interestingly, while zinc transport mutants show significant growth defects in defined minimal media, they grow normally in human urine, suggesting that urine contains sufficient bioavailable zinc to support bacterial growth even in the absence of high-affinity transporters .

What is the role of ZupT in uropathogenic E. coli (UPEC) virulence?

ZupT contributes to uropathogenic E. coli virulence during urinary tract infection (UTI), though its role is secondary to that of the ZnuACB system. In vivo infection studies in the murine ascending UTI model reveal:

StrainCompetitive Index in BladderCompetitive Index in KidneysSingle-Strain Infection
CFT073 ΔzupTNo significant disadvantageNo significant disadvantageNot significantly reduced
CFT073 ΔznuACB4.4-fold reduction41-fold reductionSignificantly reduced in kidneys (P = 0.0012)
CFT073 ΔznuACB ΔzupT30-fold reduction48-fold reductionSignificantly reduced in kidneys (P < 0.0001)

These results demonstrate that while loss of ZupT alone does not significantly impact UPEC virulence, the combined loss of ZnuACB and ZupT has a cumulative negative effect on bacterial fitness during UTI . This suggests that zinc acquisition during infection is primarily mediated by ZnuACB, with ZupT playing a supplementary role that becomes more important when ZnuACB is absent.

The reduced virulence of zinc transport mutants may be attributed to:

  • Decreased motility, which impairs bacterial ascension in the urinary tract

  • Reduced resistance to oxidative stress and hydrogen peroxide, compromising bacterial survival in the inflammatory environment of infected tissues

Both defects can be restored by zinc supplementation, confirming they result from impaired zinc acquisition rather than pleiotropic effects of the mutations .

How do environmental conditions affect ZupT expression and function?

ZupT expression and function are influenced by environmental conditions, particularly zinc availability. Unlike ZnuACB, which is regulated by the zinc-responsive Zur repressor, ZupT regulation is less well characterized but appears to be constitutive or regulated by different mechanisms.

The relative importance of ZupT varies across different host environments:

  • In urine: ZupT appears less critical as zinc levels in human urine (approximately 9 μM/day in healthy individuals) are generally sufficient to support bacterial growth even in the absence of high-affinity transporters . Both wild-type and zinc transport mutants grow similarly in human urine in vitro .

  • In intracellular environments: During intracellular bacterial community formation in bladder epithelial cells, zinc availability may be limited as host cells sequester zinc in metallothioneins and specific storage vacuoles . Under these conditions, zinc transporters like ZupT may become more important for bacterial survival.

  • During systemic infection: In plasma, zinc is predominantly bound to albumin and α2-macroglobulin, while during inflammation, neutrophil-derived calprotectin can further sequester zinc . These host zinc-withholding mechanisms may increase bacterial reliance on efficient zinc acquisition systems during systemic infection.

The heightened importance of ZupT in zinc-restricted environments is evidenced by the more severe phenotypes of ΔzupT mutants under experimental zinc limitation and in specific host niches during infection .

What is the relationship between ZupT-mediated zinc transport and bacterial resistance to oxidative stress?

A significant finding is that ZupT contributes to E. coli resistance to oxidative stress. Experimental data shows:

  • Zinc transport-deficient mutants (particularly ΔznuACB ΔzupT) exhibit increased sensitivity to hydrogen peroxide compared to wild-type strains .

  • This increased sensitivity to oxidative stress can be reversed by zinc supplementation, confirming that the phenotype is directly related to zinc availability rather than pleiotropic effects of the mutations .

Several mechanisms may explain how zinc transport systems contribute to oxidative stress resistance:

  • Zinc protects against iron-triggered membrane lipid oxidation, which may partially explain why Znu- and ZupT-mediated zinc transport provides resistance to oxidative stress .

  • Zinc is a cofactor for enzymes belonging to six different major functional groups in E. coli, including those potentially involved in oxidative stress response .

  • Zinc may compete with redox-active metals like iron for binding sites on macromolecules, thereby preventing oxidative damage.

This connection between zinc transport and oxidative stress resistance represents an important aspect of bacterial physiology that could explain why zinc acquisition systems contribute to pathogen fitness during infection, particularly in inflammatory environments where reactive oxygen species are abundant .

How can researchers effectively generate and validate functional ZupT mutants?

Creating and validating functional ZupT mutants requires careful experimental design. Based on established methodologies:

Generation of ZupT mutants:

  • Use lambda Red recombinase-based gene replacement to create clean deletion mutants (ΔzupT)

  • Replace the target gene with an antibiotic resistance cassette flanked by FRT (FLP recognition target) sites

  • Verify deletions by PCR and sequencing of the junction regions

  • Remove the antibiotic resistance marker using FLP recombinase if creating multiple mutations in the same strain

Validation of ZupT mutants:

  • Genotypic validation: Confirm gene deletion by PCR and sequencing

  • Phenotypic validation: Assess growth in zinc-limited media, with zinc chelators such as EDTA or EGTA (200-500 μM)

  • Functional validation: Measure ⁶⁵Zn²⁺ uptake to directly quantify transport activity

  • Complementation studies: Introduce plasmid-expressed wild-type zupT to restore function, confirming phenotypes are due to loss of ZupT rather than polar effects

  • Controls: Include appropriate control strains (wild-type, other zinc transport mutants) for comparative analysis

For a comprehensive functional analysis, researchers should examine both single mutants (ΔzupT) and combined mutations (ΔznuACB ΔzupT) to capture the potential redundancy and compensatory mechanisms in zinc transport systems .

What are the optimal experimental conditions for studying ZupT-mediated zinc transport?

For robust assessment of ZupT-mediated zinc transport, researchers should consider these experimental parameters:

Growth conditions:

  • Use defined minimal media such as Davis minimal medium supplemented with 0.4% glucose for zinc limitation studies

  • Include zinc chelators (EDTA or EGTA at 200-500 μM) to create zinc-limited conditions

  • Prepare media using ultra-pure water and acid-washed glassware to minimize zinc contamination

  • Maintain consistent temperature (37°C) and aeration conditions

Isotope uptake assays:

  • Grow bacteria in zinc-deficient conditions (DT broth overnight, followed by DT-EGTA 200 μM for 2 hours)

  • Wash cells thoroughly with DT-EGTA (500 μM) to remove surface-bound metals

  • Adjust bacterial density to OD₆₀₀ of 0.5 (approximately 10⁸ cells/ml)

  • Add ⁶⁵Zn²⁺ at a defined concentration (e.g., 20 nM)

  • Incubate for a short, standardized time (15 minutes) at 37°C

  • Wash cells thoroughly with cold DT-EGTA (1 mM) to remove unbound isotope

  • Measure radioactivity using a scintillation counter

  • Include appropriate controls:

    • Zinc transport-deficient strain without isotope (background control)

    • Samples with known ⁶⁵Zn²⁺ concentration for standardization

Complementation studies:

  • Use vectors with controlled expression systems to avoid artifacts from overexpression

  • Include empty vector controls to account for vector-related effects

  • Verify protein expression by immunoblotting when possible

These standardized conditions enable reliable quantification of ZupT-mediated zinc transport activity and meaningful comparisons between different strains and experimental conditions.

How does the SitABCD transport system interact with ZupT in zinc acquisition?

The SitABCD transporter represents a potential alternative pathway for zinc acquisition in E. coli, though its contribution appears limited compared to ZnuACB and ZupT. Research findings reveal:

These findings suggest that while SitABCD may have some capacity for zinc binding, its physiological role in zinc homeostasis is minimal compared to the dedicated zinc transporters ZnuACB and ZupT. The primary function of SitABCD appears to be in manganese and iron transport, with zinc transport being a secondary activity .

What mechanisms underlie the differential regulation of zinc transporters in pathogenic versus non-pathogenic E. coli?

The differential regulation of zinc transporters between pathogenic and non-pathogenic E. coli remains incompletely understood. Current evidence suggests:

  • While both E. coli K-12 and UPEC CFT073 possess the same zinc transport systems (ZnuACB and ZupT), their relative importance and regulation may differ in these strains .

  • In UPEC CFT073, ZnuACB appears to be the predominant zinc transporter, with ZupT playing a secondary role, as evidenced by growth assays and ⁶⁵Zn²⁺ uptake studies .

  • The contribution of these transporters to bacterial fitness differs between laboratory and host environments - while zinc transport mutants show growth defects in defined minimal media, they grow normally in human urine .

  • The importance of zinc transporters is heightened during infection, suggesting that zinc availability may be limited in certain host niches despite apparently adequate zinc levels in urine from healthy individuals .

Future research should investigate:

  • The transcriptional and post-transcriptional regulation of znuACB and zupT genes in pathogenic versus non-pathogenic E. coli

  • How host inflammation and immune responses affect zinc availability and transporter expression during infection

  • The potential cross-regulation between different metal transport systems in response to varying environmental signals

  • The spatiotemporal dynamics of zinc availability within different host niches during infection

Understanding these regulatory mechanisms could provide insights into bacterial adaptation to host environments and potentially identify novel targets for antimicrobial intervention.

How might targeting zinc transport systems be exploited for antimicrobial development?

The essential role of zinc transport systems in bacterial pathogenesis suggests potential for antimicrobial development. Targeting these systems could:

  • Reduce bacterial fitness during infection, particularly in host environments where zinc is limited or sequestered as part of nutritional immunity .

  • Impair bacterial resistance to oxidative stress, enhancing susceptibility to host immune defenses and oxidative antimicrobials .

  • Decrease bacterial motility, potentially reducing the ability of pathogens to ascend the urinary tract and establish infection in the kidneys .

  • Create synergistic effects when combined with conventional antibiotics, particularly those that induce oxidative stress.

Potential approaches for targeting zinc transport systems include:

  • Development of small molecule inhibitors that block zinc binding to periplasmic binding proteins or disrupt transporter function

  • Design of zinc-chelating compounds that can effectively compete with bacterial transporters for available zinc

  • Creation of zinc mimetics that can be recognized by transporters but fail to fulfill the metabolic functions of zinc

  • Exploitation of differences in zinc transport regulation between pathogenic and commensal bacteria to achieve selective targeting

The significant reduction in fitness observed in zinc transport mutants during UTI, particularly in the kidneys, suggests that such approaches could be especially effective against ascending urinary tract infections caused by uropathogenic E. coli .

What are common challenges in zinc transport studies and how can they be addressed?

Researchers studying zinc transport in E. coli frequently encounter these challenges:

Challenge 1: Zinc contamination from the environment

  • Problem: Trace zinc contamination from glassware, water, or reagents can mask phenotypes of zinc transport mutants .

  • Solution: Use ultra-pure water, acid-wash all glassware, prepare media with high-purity reagents, and verify zinc levels in experimental media using atomic absorption spectroscopy.

Challenge 2: Redundancy in zinc transport systems

  • Problem: Multiple transport systems with overlapping functions can compensate for each other, obscuring phenotypes of single mutants .

  • Solution: Create and analyze multiple mutants lacking different combinations of transport systems (e.g., ΔznuACB ΔzupT double mutants) to reveal the full contribution of each system .

Challenge 3: Variable zinc availability in different growth media

  • Problem: Different media contain variable amounts of zinc, leading to inconsistent results across experiments .

  • Solution: Use defined minimal media with controlled zinc levels, and include appropriate chelators (EDTA or EGTA) to create zinc-limited conditions .

Challenge 4: Translating in vitro findings to in vivo relevance

  • Problem: Zinc transport mutants may behave differently in laboratory media versus host environments .

  • Solution: Include physiologically relevant conditions (e.g., growth in human urine) and validate findings using appropriate animal infection models .

Challenge 5: Distinguishing direct from indirect effects of zinc limitation

  • Problem: Phenotypes observed in zinc transport mutants may result from indirect metabolic effects rather than direct zinc limitation .

  • Solution: Perform complementation studies and demonstrate rescue of phenotypes by zinc supplementation to confirm direct relationship to zinc availability .

Addressing these challenges through careful experimental design and appropriate controls will enhance the reliability and reproducibility of zinc transport studies in E. coli.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.