Recombinant Escherichia coli O81 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Escherichia coli O81 4-hydroxybenzoate octaprenyltransferase (UbiA) is a membrane-bound enzyme critical in ubiquinone (UQ) biosynthesis. It catalyzes the prenylation of 4-hydroxybenzoate (4-HB) with an octaprenyl group to form 3-octaprenyl-4-hydroxybenzoate, a key intermediate in UQ-8 production . The enzyme is encoded by the ubiA gene and is functionally conserved across bacteria and eukaryotes, sharing homology with Saccharomyces cerevisiae COQ2 .

Recombinant Production and Purification

The recombinant protein is expressed in E. coli systems (e.g., BL21(DE3)) with an N-terminal His-tag for affinity chromatography . Key production parameters include:

  • Expression System: E. coli .

  • Purification: Immobilized metal affinity chromatography (IMAC).

  • Purity: ≥85% (SDS-PAGE) .

  • Storage: Lyophilized powder in Tris-based buffer with 50% glycerol at -20°C .

Functional Insights

  • Catalytic Mechanism: UbiA transfers an octaprenyl chain from octaprenyl diphosphate to 4-HB, forming a lipophilic intermediate for subsequent UQ-8 modifications .

  • Regulation:

    • Glucose Repression: ubiA expression is catabolite-repressed under high glucose conditions .

    • Oxygen Sensitivity: Expression is modulated by the ArcA transcriptional regulator under anaerobic conditions .

  • Functional Complementation: ubiA mutants can be rescued by yeast COQ2, demonstrating broad substrate specificity .

Research Applications

  • Ubiquinone Biosynthesis Studies: Used to dissect UQ-8 biosynthesis pathways in E. coli .

  • Oxidative Stress Analysis: Overexpression linked to redox imbalance during periplasmic Fab production, increasing superoxide levels .

  • Enzyme Engineering: Structural studies inform the design of UbiA superfamily inhibitors .

Recent Research Findings

  • Anaerobic UQ Synthesis: UbiA collaborates with UbiTUV proteins for O2-independent UQ-8 production, essential for nitrate respiration .

  • Pathway Interdependence: UQ-8 deficiency disrupts disulfide bond formation in recombinant antibodies, highlighting its role in redox homeostasis .

Table 2: Key Research Milestones

Study FocusFindingsSources
Complementation with COQ2Yeast COQ2 restores UQ-8 synthesis in ubiA mutants
Glucose RepressionubiA expression downregulated by glucose via ArcA
Anaerobic UQ SynthesisUbiTUV supports O2-independent hydroxylation of UQ precursors
Industrial ApplicationsUbiA activity limits Fab yields due to quinone pool partitioning

Future Directions

  • Structural Resolution: Cryo-EM studies to elucidate membrane-binding mechanisms .

  • Biotechnological Optimization: Engineering ubiA variants to enhance UQ-8 production in industrial strains .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiA; ECED1_4755; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
ubiA
Target Protein Sequence
MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY WSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. This step involves the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of 4-hydroxybenzoate octaprenyltransferase (ubiA) in E. coli?

The 4-hydroxybenzoate octaprenyltransferase (ubiA) in Escherichia coli catalyzes a critical step in ubiquinone biosynthesis, specifically the conversion of 4-hydroxybenzoate into 3-octaprenyl-4-hydroxybenzoate . This enzyme facilitates the attachment of an octaprenyl side chain to 4-hydroxybenzoate, which is an essential step in the pathway leading to ubiquinone (coenzyme Q) formation. Ubiquinone functions as an electron carrier in aerobic respiration, making ubiA indispensable for respiratory metabolism in E. coli . The reaction requires Mg²⁺ as a cofactor for optimal enzymatic activity, and both the side-chain precursor and the enzyme itself are membrane-bound .

How can researchers effectively isolate and characterize ubiA mutants in E. coli?

To isolate and characterize ubiA mutants, researchers should implement a systematic approach:

  • Mutant Selection: Screen for ubiquinone-deficient strains using respiratory growth defects on non-fermentable carbon sources. Mutants can be isolated based on their inability to grow on minimal media with succinate or other non-fermentable substrates as sole carbon sources .

  • Genetic Mapping: Confirm the mutation location through complementation analysis and genetic mapping techniques. The ubiA gene is located at minute 79 on the E. coli chromosome map .

  • Biochemical Confirmation: Assay the enzymatic activity by measuring the conversion of 4-hydroxybenzoate to 3-octaprenyl-4-hydroxybenzoate. Mutants lacking ubiA will show no enzymatic activity in this assay .

  • Gene Replacement: Create defined ubiA mutants through chromosomal gene replacement techniques. For example, researchers have successfully replaced the ubiA gene with a chloramphenicol resistance gene to create defined knockout strains .

  • Phenotypic Analysis: Characterize the respiration-defective phenotype through oxygen consumption measurements and growth kinetics analysis .

What are the optimal conditions for expressing recombinant ubiA in E. coli expression systems?

For optimal expression of recombinant ubiA in E. coli expression systems, consider the following methodological approaches:

Table 1: Optimized Expression Conditions for Recombinant ubiA

ParameterRecommended ConditionRationale
Host StrainE. coli BL21(DE3)Lacks certain proteases; suitable for membrane protein expression
Expression VectorpBAD or pTet-based systemsAllows tight regulation of expression levels
InductionLow inducer concentrationsPrevents toxic effects from overexpression of membrane proteins
Temperature25-30°C post-inductionReduces inclusion body formation and facilitates proper membrane insertion
Media Supplementation1% glucose during growth phase; remove during inductionControls basal expression due to catabolite repression
Membrane Fraction IsolationDifferential centrifugation (100,000×g)Separates membrane fraction containing functional ubiA
Detergent SolubilizationMild detergents (DDM or LDAO)Maintains protein structure while extracting from membrane

When expressing ubiA, researchers should be aware that expression is catabolite-repressed by glucose, and this repression is particularly evident in arcA mutant strains . For functional studies, ensure that the expression system includes adequate magnesium supplementation, as Mg²⁺ is required for optimal enzyme activity .

What methodologies are most effective for measuring ubiA enzymatic activity in vitro?

For robust measurement of ubiA enzymatic activity, implement the following protocol:

  • Membrane Preparation: Isolate membrane fractions from E. coli expressing ubiA through differential centrifugation, as both the enzyme and substrate precursors are membrane-bound .

  • Reaction Conditions:

    • Buffer: 50 mM Tris-HCl, pH 7.5

    • Cofactor: 5-10 mM MgCl₂ (essential for optimal activity)

    • Substrates: 4-hydroxybenzoate (100-200 μM) and octaprenyl diphosphate (50-100 μM)

    • Temperature: 30-37°C

    • Time: 30-60 minutes

  • Product Detection Methods:

    • HPLC separation with UV detection at 254 nm

    • LC-MS/MS for more sensitive detection and confirmation

    • Radiolabeled substrate approach using ¹⁴C-labeled 4-hydroxybenzoate

  • Activity Calculations:

    • Measure the formation rate of 3-octaprenyl-4-hydroxybenzoate

    • Express activity as nmol product formed per minute per mg protein

  • Controls:

    • Negative control: Membranes from ubiA mutant strains

    • Positive control: Purified recombinant ubiA or membranes from ubiA-overexpressing strains

This assay can be adapted to study enzyme kinetics, substrate specificity, and the effects of inhibitors on ubiA activity.

How does the substrate specificity of ubiA compare to its homologs from other organisms?

The substrate specificity of E. coli ubiA shows interesting patterns when compared to its homologs:

Table 2: Comparative Substrate Specificity of Prenyltransferases

EnzymeOrganismAromatic SubstratePrenyl SubstrateSide Chain LengthCross-Complementation
UbiAE. coli4-hydroxybenzoateOctaprenyl diphosphateC40 (8 units)-
COQ2S. cerevisiae4-hydroxybenzoateHexaprenyl diphosphateC30 (6 units)Complements E. coli ubiA mutants
UbiAOther bacteria4-hydroxybenzoateVaries by speciesVaries by speciesSpecies-dependent

The E. coli UbiA normally utilizes octaprenyl diphosphate as its prenyl substrate, leading to the formation of ubiquinone-8 (UQ-8) with an eight-isoprenoid unit side chain . Interestingly, the COQ2 gene from Saccharomyces cerevisiae, which normally uses hexaprenyl diphosphate to produce ubiquinone-6 (UQ-6), can functionally complement E. coli ubiA mutants. When expressed in ubiA-deficient E. coli, COQ2 catalyzes the production of ubiquinone-8, demonstrating that COQ2 has broader substrate specificity regarding the length of the prenyl chain .

This flexibility in substrate recognition is significant as it suggests conservation of the catalytic mechanism despite evolutionary divergence. The ability of COQ2 to utilize octaprenyl diphosphate when expressed in E. coli indicates that the length of the isoprenoid side chain in ubiquinone is primarily determined by the available prenyl diphosphate synthase in the cell (encoded by ispB in E. coli) rather than by strict substrate specificity of the prenyltransferase .

How is ubiA expression regulated in response to environmental conditions?

The expression of ubiA in E. coli is subject to sophisticated regulatory mechanisms that respond to environmental cues:

  • Catabolite Repression: Expression of ubiA is catabolite-repressed by glucose, a mechanism that aligns ubiquinone production with cellular energy needs. This repression is particularly pronounced in arcA mutant strains .

  • Oxygen Regulation: While classical ubiquinone biosynthesis enzymes function under aerobic conditions, related enzymes like UbiUVT operate under anaerobic conditions. The transcription of these genes is controlled by the O₂-sensing Fnr transcriptional regulator, suggesting a complex regulatory network for ubiquinone biosynthesis that responds to oxygen availability .

  • Transcriptional Organization: Studies using ubiA-lacZ fusion systems have revealed insights into the transcriptional regulation of ubiA. The gene is part of a transcriptional unit that responds to metabolic conditions, particularly those affecting respiratory metabolism .

  • ArcA-Dependent Regulation: ArcA, a positively acting transcriptional regulator of oxygen-regulated genes, influences ubiA expression. In arcA mutants, glucose repression of ubiA becomes more evident, suggesting ArcA's role in modulating the metabolic control of ubiquinone biosynthesis .

These regulatory mechanisms ensure that ubiquinone production is coordinated with cellular respiration needs and metabolic status.

What is the relationship between ubiA function and respiratory chain activity in E. coli?

The relationship between ubiA function and respiratory chain activity in E. coli is multifaceted:

  • Electron Transport Dependency: UbiA catalyzes a critical step in the biosynthesis of ubiquinone (coenzyme Q), which functions as an electron carrier in the respiratory chain. Ubiquinone accepts electrons from NADH dehydrogenase and succinate dehydrogenase, transferring them to cytochrome complexes .

  • Respiratory Deficiency in Mutants: Strains with disrupted ubiA exhibit a respiration-defective phenotype, characterized by inability to grow on non-fermentable carbon sources and reduced oxygen consumption rates .

  • Redox Balance Impact: Expression of periplasmic proteins requiring disulfide bond formation, such as antibody fragments (Fab), increases demand for electron flux through ubiquinone. Research has shown that Fab expression in E. coli interferes with intracellular redox balance, affecting respiratory chain function. Exogenous supplementation with ubiquinone analogs improves yields by up to 82%, suggesting that partitioning of the quinone pool between respiration and oxidative processes is a limiting factor .

  • Oxidative Stress Connection: During respiratory metabolism, reactive oxygen species (ROS) are generated as byproducts. Ubiquinone, produced through the pathway involving ubiA, also serves as an antioxidant. Disruption of ubiA leads to increased susceptibility to oxidative stress, as evidenced by the activation of oxidative stress-responsive genes like soxS in strains with altered ubiquinone metabolism .

  • Anaerobic Adaptation: While ubiA is primarily associated with aerobic respiration, recent research has identified an anaerobic O₂-independent ubiquinone biosynthesis pathway involving UbiUVT proteins. This pathway enables E. coli to maintain some ubiquinone production under anaerobic conditions, highlighting the versatility of respiratory adaptations .

These interactions demonstrate that ubiA function is integrally linked to respiratory chain activity, redox homeostasis, and stress responses in E. coli.

What are the most effective strategies for engineering ubiA to modify substrate specificity or increase catalytic efficiency?

Engineering ubiA for modified substrate specificity or enhanced catalytic efficiency requires sophisticated approaches:

  • Structure-Guided Mutagenesis: Based on sequence alignments with homologs like COQ2 from yeast, researchers can identify conserved residues likely involved in substrate binding or catalysis. Targeted mutagenesis of these residues can alter substrate preference or enhance catalytic parameters .

  • Domain Swapping: Create chimeric enzymes by swapping domains between ubiA and functionally related prenyltransferases from different organisms. This approach can transfer desirable properties while maintaining essential structural integrity.

  • Active Site Modification: Target residues in the active site that interact with either the aromatic substrate or the prenyl donor. For example:

    • Mutations expanding the prenyl binding pocket may accommodate longer prenyl chains

    • Modifications to the aromatic substrate binding region could alter specificity for derivatives of 4-hydroxybenzoate

  • Directed Evolution:

    • Implement error-prone PCR to generate ubiA variants

    • Develop a selective screening system based on ubiquinone-dependent growth

    • Use fluorescence-activated cell sorting (FACS) with ubiquinone-responsive reporters to identify improved variants

  • Computational Design: Employ molecular modeling and simulations to predict mutations that might enhance substrate binding or catalytic efficiency before experimental validation.

  • Membrane Environment Optimization: As a membrane-bound enzyme, ubiA function is influenced by the lipid environment. Engineer expression systems with modified membrane composition or utilize nanodiscs with defined lipid composition for in vitro studies.

Table 3: Potential Mutation Targets in ubiA Based on Conserved Domains

DomainFunctionPotential Mutation TargetsExpected Effect
Prenyl Binding DomainBinds octaprenyl diphosphateHydrophobic residues lining binding pocketAltered prenyl chain length specificity
Aromatic Substrate BindingBinds 4-hydroxybenzoateResidues forming hydrogen bonds with substrateChanged specificity for aromatic substrates
Catalytic DomainFacilitates prenyl transferConserved aspartate residuesModified catalytic efficiency
Mg²⁺ Binding SiteCoordinates essential cofactorAcidic and polar residuesAltered metal dependency
Membrane InterfaceAnchors protein in membraneResidues at lipid-protein interfaceChanged membrane association

These approaches can be utilized to engineer ubiA variants suitable for synthesizing modified ubiquinones with altered side chains or for improving the efficiency of ubiquinone production.

What is the current understanding of the three-dimensional structure of ubiA and how does it inform mechanistic studies?

While the search results don't provide detailed information on the three-dimensional structure of E. coli ubiA specifically, we can construct a comprehensive understanding based on available data and related structures:

  • Membrane Protein Topology: UbiA is a membrane-bound protein with multiple transmembrane domains. Analysis of its amino acid sequence reveals a pattern of hydrophobic regions consistent with transmembrane helices that anchor the protein in the cytoplasmic membrane .

  • Active Site Architecture: Based on biochemical studies, the active site likely contains:

    • A binding pocket for 4-hydroxybenzoate

    • A separate binding region for the octaprenyl diphosphate

    • A Mg²⁺ coordination site essential for catalysis

  • Mechanism Insights: The catalytic mechanism likely involves:

    • Coordination of the diphosphate moiety by Mg²⁺

    • Activation of the aromatic ring of 4-hydroxybenzoate for nucleophilic attack

    • Transfer of the prenyl group with release of pyrophosphate

  • Homology Modeling: Structural insights can be gained through homology modeling based on related prenyltransferases with solved structures. The catalytic core likely adopts a similar fold to other members of the prenyltransferase family.

  • Functional Domains: The protein can be divided into functional domains:

    • N-terminal region involved in membrane anchoring

    • Central catalytic domain containing the active site

    • Substrate recognition elements that determine specificity

For researchers investigating ubiA structure-function relationships, experimental approaches including:

  • Site-directed mutagenesis of predicted catalytic residues

  • Cross-linking studies to identify substrate interaction sites

  • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

  • Expression and purification strategies optimized for subsequent structural studies

  • Crystallization trials using lipidic cubic phase or detergent-based methods suitable for membrane proteins

A comprehensive understanding of ubiA structure would significantly advance our knowledge of prenyl transfer mechanisms and facilitate rational enzyme engineering for biotechnological applications.

What are the most reliable methods for purifying active recombinant ubiA for biochemical studies?

Purifying active recombinant ubiA requires specialized techniques due to its membrane-bound nature:

  • Expression Optimization:

    • Use E. coli BL21(DE3) or C41(DE3)/C43(DE3) strains designed for membrane protein expression

    • Employ low temperature induction (18-25°C) to improve proper folding

    • Include 1% glucose during growth phase, but remove during induction to prevent catabolite repression

  • Membrane Extraction:

    • Harvest cells and disrupt by French press or sonication in buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, and protease inhibitors

    • Separate membrane fraction by ultracentrifugation (100,000×g for 1 hour)

    • Wash membranes to remove peripheral proteins

  • Solubilization:

    • Solubilize membranes using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1-2% in solubilization buffer

    • Include 5 mM MgCl₂ throughout purification to maintain structural integrity

    • Incubate with gentle agitation for 1-2 hours at 4°C

  • Affinity Purification:

    • For His-tagged constructs, use Ni-NTA chromatography with detergent-containing buffers

    • Include 5 mM MgCl₂ and 10% glycerol in all purification buffers

    • Elute with imidazole gradient (50-300 mM)

  • Further Purification:

    • Size exclusion chromatography to separate aggregates and obtain homogeneous preparation

    • Ion exchange chromatography as an additional purification step if needed

  • Activity Preservation:

    • Maintain 0.03-0.05% DDM in final storage buffer to prevent aggregation

    • Include 10% glycerol and 1 mM DTT to stabilize the protein

    • Flash-freeze aliquots in liquid nitrogen and store at -80°C

  • Alternative Approaches:

    • Nanodiscs or amphipols for detergent-free stabilization

    • Cell-free expression systems with direct incorporation into liposomes

Table 4: Troubleshooting Guide for ubiA Purification

ProblemPossible CauseSolution
Low expressionToxicity of overexpressed membrane proteinUse tightly regulated expression systems; lower induction temperature
Poor solubilizationInadequate detergent or concentrationScreen different detergents; optimize detergent:protein ratio
Loss of activityDetergent-induced conformational changesTry milder detergents or lipid-like surfactants
AggregationProtein instabilityInclude stabilizing additives; optimize buffer composition
Low purityCo-purifying membrane proteinsInclude additional purification steps; optimize washing conditions

By carefully optimizing each step in this process, researchers can obtain active recombinant ubiA suitable for detailed biochemical and structural studies.

How can researchers effectively study the integration of ubiA into the broader ubiquinone biosynthetic pathway?

Studying the integration of ubiA within the ubiquinone biosynthetic pathway requires multifaceted approaches:

  • Metabolic Profiling:

    • LC-MS/MS to detect and quantify pathway intermediates

    • Isotope labeling using ¹³C-labeled precursors to track flux through the pathway

    • Comparison of intermediate profiles between wild-type and mutant strains

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation to identify interacting partners

    • Bacterial two-hybrid assays for in vivo interaction mapping

    • Crosslinking mass spectrometry to capture transient interactions

    • Fluorescence resonance energy transfer (FRET) for monitoring interactions in living cells

  • Gene Expression Coordination:

    • Transcriptomics to assess co-regulation patterns

    • Promoter-reporter fusions to monitor expression under varying conditions

    • ChIP-seq to identify transcription factors regulating ubiA and other pathway genes

  • Metabolic Engineering Approaches:

    • Overexpression of pathway enzymes to identify rate-limiting steps

    • Creation of synthetic operons with controlled expression of multiple pathway genes

    • Engineering of sensor systems to monitor pathway flux

  • Systems Biology Integration:

    • Flux balance analysis to model pathway dynamics

    • Integration of transcriptomic, proteomic, and metabolomic data

    • Identification of regulatory nodes affecting pathway flux

  • Subcellular Localization and Enzyme Complex Formation:

    • Fluorescence microscopy with tagged proteins to visualize localization

    • Membrane fractionation to identify micro-domains

    • Blue native PAGE to identify potential multi-enzyme complexes

Recent research has demonstrated that several enzymes involved in ubiquinone biosynthesis form a multiprotein complex called the Ubi metabolon, involving factors like UbiJ and UbiK . It would be valuable to investigate whether ubiA is also part of this complex or interacts with it transiently.

Additionally, researchers should consider the parallel pathways that have recently been discovered, such as the anaerobic ubiquinone biosynthesis pathway involving UbiUVT that operates under O₂-independent conditions . Understanding how the cell regulates and coordinates these parallel pathways would provide significant insights into metabolic flexibility and adaptation.

How do the functional characteristics of E. coli ubiA compare with homologous enzymes across different species?

A comparative analysis of ubiA and its homologs reveals important evolutionary and functional relationships:

Table 5: Comparative Analysis of ubiA Homologs Across Species

OrganismEnzymeMolecular WeightSubstrate SpecificityUnique FeaturesComplementation of E. coli ubiA
E. coliUbiA32.54 kDa4-hydroxybenzoate + octaprenyl-PPMg²⁺ dependent; membrane-boundReference
S. cerevisiaeCOQ2~37 kDa4-hydroxybenzoate + hexaprenyl-PPFunctions in mitochondriaYes; produces UQ-8 in E. coli
H. sapiensCOQ2~42 kDa4-hydroxybenzoate + decaprenyl-PPAssociated with CoQ10 deficiency disordersPartial complementation
PlantsHST/VTE2~38 kDaHomogentisate + phytyl-PP/solanesyl-PPDual pathway (tocopherol/plastoquinone)No complementation
ArchaeaUbiA-likeVariableVarious aromatic substratesGreater diversity of productsSpecies-dependent

The functional comparison reveals several significant patterns:

  • Substrate Flexibility: While each enzyme has preferred substrates, there is remarkable flexibility, particularly regarding the prenyl donor. The successful complementation of E. coli ubiA mutants by yeast COQ2 demonstrates that the yeast enzyme can accept the longer octaprenyl diphosphate substrate when expressed in E. coli .

  • Structural Conservation: Despite divergence in primary sequence, the core catalytic mechanism appears conserved across diverse species, suggesting an ancient evolutionary origin for this enzyme family.

  • Specialized Adaptations: Species-specific adaptations have evolved to accommodate different cellular contexts (bacterial membrane vs. mitochondrial inner membrane) and metabolic requirements.

  • Divergent Functions: In some lineages, particularly plants, ubiA homologs have evolved to participate in separate biosynthetic pathways, including those for tocopherols (vitamin E) and plastoquinones.

  • Cofactor Requirements: The dependence on magnesium as a cofactor appears to be conserved across homologs, reflecting the common mechanism involving coordination of the pyrophosphate group .

This comparative perspective provides valuable insights for researchers seeking to understand the evolution of prenyl transfer reactions and offers opportunities for biotechnological applications through the strategic selection or engineering of homologs with desired properties.

What are the most promising future research directions involving E. coli ubiA and its applications in biotechnology?

Future research involving E. coli ubiA presents several promising directions:

  • Structural Biology Advancements: Determining the high-resolution structure of ubiA would significantly advance our understanding of its catalytic mechanism and substrate specificity. Cryo-electron microscopy or X-ray crystallography of ubiA in nanodiscs or detergent micelles represents a challenging but valuable goal.

  • Synthetic Biology Applications: Engineering ubiA and related enzymes could enable the production of novel prenylated compounds with potential applications in pharmaceuticals, nutraceuticals, and materials science. Creating variants with modified substrate specificities could generate ubiquinone analogs with tailored properties.

  • Metabolic Engineering: Optimizing the entire ubiquinone biosynthetic pathway, including ubiA, could enhance the production of ubiquinone for commercial applications. This might involve balancing expression levels, eliminating bottlenecks, and coordinating with cellular metabolism.

  • Redox Engineering: Given the connection between ubiA function and cellular redox balance , strategic manipulation of ubiquinone synthesis could enhance cellular tolerance to oxidative stress and improve production of disulfide-bonded recombinant proteins.

  • Comparative Systems Biology: Exploring how different organisms have optimized their ubiquinone biosynthetic pathways could reveal alternative solutions to common metabolic challenges and inspire new engineering approaches.

  • Therapeutic Applications: Understanding ubiA function could inform strategies for addressing ubiquinone deficiencies in human cells, potentially through the development of small molecules that enhance ubiquinone biosynthesis.

  • Integration with Alternate Energy Metabolism: Investigating the interplay between the classical ubiquinone pathway (involving ubiA) and the alternative anaerobic pathway (involving UbiUVT) could reveal sophisticated regulatory mechanisms and adaptation strategies.

As researchers continue to explore these directions, the fundamental understanding of ubiA will expand, potentially leading to innovative applications across multiple fields of biotechnology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.