Recombinant Escherichia coli O81 Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
clsA; cls; ECED1_1401; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
clsA
Target Protein Sequence
MTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCERRQGIAGVKGNQ LQLMTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLAIDDKGFGADLAAVQDDYISRSRLLDARLWLKRPLWQRVAERLFY FFSPLL
Uniprot No.

Target Background

Function
Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.
Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular function of Cardiolipin synthase in E. coli?

Cardiolipin synthase (cls) in E. coli catalyzes the synthesis of cardiolipin (CL), an anionic phospholipid critical for membrane structure and function. The enzyme functions through phospholipase D (PLD) activity, transferring a phosphatidyl residue from one phosphatidylglycerol (PG) molecule to another to form cardiolipin . In E. coli, cls contains the characteristic HKD motif of the phospholipase D superfamily . The enzyme primarily catalyzes transphosphatidylation between two phosphatidylglycerol molecules, with one acting as a phosphatidyl donor and the other as an acceptor .

How many Cardiolipin synthase isoenzymes exist in E. coli and how do they differ?

IsoenzymePrimary FunctionDistinct CharacteristicsSubstrate Preference
ClsACL synthesisActivated during stationary phase Preferentially uses PG as substrate
ClsBCL synthesis with trans-phosphatidylationShows appreciable phosphatidylalcohol synthesis Broader substrate range including primary alcohols
ClsCCL synthesisLess studied than ClsA and ClsBNot fully characterized

LC-MS analysis reveals that overexpression or deletion of individual cls enzymes affects both lipid class distribution and CL species profiles . Notably, only ClsB shows appreciable synthesis of phosphatidylalcohols when overexpressed, demonstrating classic PLD activity through phospholipid headgroup exchange .

What expression systems are optimal for producing recombinant E. coli Cardiolipin synthase?

For recombinant expression of E. coli Cardiolipin synthase, E. coli-based expression systems are typically employed. The following methodology has proven effective:

  • Vector selection: Plasmids with strong inducible promoters (T7, tac) with appropriate fusion tags (often His-tag for purification)

  • Host strain: Common E. coli expression strains include BL21(DE3) derivatives which lack certain proteases and provide tight expression control

  • Expression conditions:

    • Growth in rich medium (LB) until mid-log phase (OD600 = 0.4-0.8)

    • Induction with IPTG (typically 0.1-1.0 mM)

    • Post-induction growth at lower temperatures (16-30°C) to enhance proper folding

Automated protocols such as APEX (Automated Protein EXpression) on the Opentrons OT-2 platform can be implemented for high-throughput expression, including transformation, colony selection, and protein expression induction with high reproducibility .

How can the enzymatic activity of recombinant Cardiolipin synthase be measured in vitro?

Several complementary approaches can be used to measure the enzymatic activity of recombinant Cardiolipin synthase:

Radiochemical Assay:

  • Use [14C]-labeled phosphatidylglycerol (PG) as substrate

  • Incubate with recombinant CLS and CDP-diacylglycerol

  • Extract lipids and separate by thin-layer chromatography (TLC)

  • Quantify radiolabeled cardiolipin formation

LC-MS Based Assay:

  • Incubate CLS with substrates (PG and CDP-diacylglycerol)

  • Extract lipids using chloroform/methanol extraction

  • Analyze lipid species by LC-MS/MS

  • Quantify cardiolipin species based on their mass fingerprints

In vivo Complementation:

  • Express recombinant CLS in cardiolipin synthase-deficient yeast (crd1Δ)

  • Extract mitochondria

  • Perform enzyme activity assays under varying conditions (pH, divalent cations)

  • Analyze substrate preferences for CDP-diacylglycerol versus phosphatidylglycerol species

What purification strategies are effective for obtaining high-purity recombinant Cardiolipin synthase?

Purification of membrane proteins like Cardiolipin synthase requires specialized approaches:

  • Membrane extraction:

    • Harvest cells and disrupt by sonication or French press

    • Isolate membrane fraction by ultracentrifugation

    • Solubilize membranes with appropriate detergents (typically DDM, LDAO, or Triton X-100)

  • Affinity chromatography:

    • His-tagged CLS can be purified using Ni-NTA resin

    • Wash with low concentrations of imidazole to remove non-specific binding

    • Elute with higher concentrations of imidazole (200-300 mM)

  • Further purification:

    • Size exclusion chromatography to remove aggregates and achieve higher purity

    • Ion exchange chromatography as a polishing step

  • Quality control:

    • SDS-PAGE to assess purity

    • Western blotting to confirm identity

    • Mass spectrometry to verify protein integrity

The purified enzyme should be stored in buffer containing glycerol (typically 50%) at -20°C or -80°C for extended storage, with recommendations against repeated freeze-thaw cycles .

How does cardiolipin deficiency affect biofilm formation in E. coli and what are the molecular mechanisms involved?

Research has revealed that cardiolipin plays a crucial role in biofilm formation in E. coli:

Impact on Biofilm Formation:

  • Depletion of cardiolipin reduces biofilm formation by as much as 50% in E. coli

  • The absence of cardiolipin activates the Rcs envelope stress response pathway

Molecular Mechanisms:

  • Flagellar expression: Cardiolipin-deficient cells (ΔclsABC) have significantly fewer flagella than wild-type cells, showing decreased swimming and swarming motility

  • Stress response activation: qPCR measurements show Rcs-activated transcripts are approximately 20-fold more abundant in ΔclsABC cells compared to wild-type

  • Protein translocation: Cardiolipin enhances protein translocation across the inner membrane; its absence impairs this process, possibly activating the Rcs pathway through outer membrane lipoprotein RcsF

  • Regulatory pathway: The Rcs signaling cascade leads to phosphorylation of RcsA and RcsB, enabling them to function as transcriptional regulators that repress flhDC (flagellar master regulator)

This research suggests that targeting lipid biosynthesis could be a viable approach for modulating biofilm formation and other multicellular bacterial phenotypes .

What role does Cardiolipin synthase topology play in maintaining membrane lipid asymmetry?

Recent research has uncovered a fascinating mechanism involving Cardiolipin synthase topology in maintaining membrane lipid asymmetry:

  • ClsA can "flip" its catalytic cytoplasmic domain upon depletion of phosphatidylethanolamine (PE) to supply cardiolipin to the periplasmic leaflet of the inner membrane

  • This topological inversion provides a "flippase-less" mechanism for maintaining membrane lipid asymmetry through self-organization of the lipid-synthesizing enzyme

Experimental evidence shows:

  • A conditionally lethal PE-deficient mutant requires cardiolipin on the periplasmic leaflet for viability

  • Osmotic down-shock induces topological inversion of ClsA in wild-type cells with physiological PE levels

  • Swapping the transmembrane domains (TMDs) or extending regions following the TMD hairpin interferes with cardiolipin synthesis activity

These findings highlight the dynamic nature of membrane protein topology and its role in lipid distribution within bacterial membranes.

How can quasi-experimental designs be applied to study the function of Cardiolipin synthase in E. coli?

Quasi-experimental designs can be valuable for studying Cardiolipin synthase function when randomized controlled trials are impractical. Based on the hierarchy of quasi-experimental designs, the following approaches are recommended for cls research:

A. Designs Without Control Groups:

  • One-group pretest-posttest design using a double pretest (O₁ O₂ X O₃):

    • Measure cardiolipin levels and physiological parameters at two time points (O₁, O₂)

    • Introduce cls overexpression or deletion (X)

    • Measure outcomes after intervention (O₃)

    • This design controls for maturation and testing effects

  • Removed-treatment design (O₁ X O₂ O₃ removeX O₄):

    • Measure baseline cardiolipin levels (O₁)

    • Introduce cls overexpression (X)

    • Measure outcomes (O₂, O₃)

    • Remove the overexpression system

    • Measure recovery outcomes (O₄)

    • This approach allows testing hypotheses about outcomes in both presence and absence of intervention

B. Designs Using Control Groups and Pretests:

  • Untreated control group with dependent pretest and posttest samples:

    • Intervention group: O₁ₐ X O₂ₐ

    • Control group: O₁ᵦ O₂ᵦ

    • Compare wild-type E. coli (control) with cls-modified strains under identical conditions

C. Interrupted Time-Series Design:

  • Multiple pretest and posttest observations:

    • O₁ O₂ O₃ O₄ O₅ X O₆ O₇ O₈ O₉ O₁₀

    • Particularly useful for studying cardiolipin synthesis under changing environmental conditions (stationary phase entry, osmotic stress)

These design approaches can yield more convincing evidence for causal links between cardiolipin synthase function and physiological outcomes in E. coli.

What factors affect the stability and activity of recombinant Cardiolipin synthase during purification and storage?

Several critical factors influence the stability and activity of recombinant Cardiolipin synthase:

FactorOptimal ConditionsImpact on Stability/Activity
pHAlkaline (human CLS has alkaline pH optimum) Significant deviation from optimal pH can denature the enzyme
Divalent cationsRequired (Mg²⁺, Mn²⁺) Essential cofactors for catalytic activity
DetergentMild non-ionic detergents (DDM, LDAO)Harsh detergents can denature the protein
Glycerol15-50% Prevents aggregation and maintains stability during freezing
TemperatureStore at -20°C/-80°C for long-term Avoid repeated freeze-thaw cycles
Buffer componentsTris-based buffers optimized for specific protein Buffer composition affects stability
Reducing agentsDTT or β-mercaptoethanolMay be required to prevent oxidation of cysteine residues

To maintain activity:

  • Aliquot purified enzyme to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Perform activity assays immediately after thawing

  • Consider adding lipid molecules to stabilize the membrane protein during purification

How can researchers troubleshoot low yields or inactive recombinant Cardiolipin synthase?

When facing challenges with recombinant Cardiolipin synthase expression and activity, consider these troubleshooting approaches:

Low Expression Yield Issues:

  • Codon optimization: Optimize codons for E. coli expression, particularly for rare codons

  • Expression strain selection: Test multiple expression strains (BL21, C41/C43 for membrane proteins)

  • Induction parameters: Optimize IPTG concentration (0.1-1.0 mM), temperature (16-37°C), and duration (3-24 hours)

  • Media composition: Compare LB, TB, or minimal media for optimal expression

  • Fusion tags: Test different fusion tags to improve solubility and expression

Activity Loss Issues:

  • Membrane extraction: Ensure proper membrane solubilization with appropriate detergents

  • Cofactor requirements: Add divalent cations (Mg²⁺, Mn²⁺) which are required for activity

  • Substrate quality: Use fresh substrates; degraded CDP-diacylglycerol or oxidized PG can reduce activity

  • Assay conditions: Optimize pH, temperature, and ionic strength for maximum activity

  • Protein conformation: Consider transmembrane domain integrity, which is critical for activity

Testing for activity restoration:

  • Functional complementation: Express the recombinant cls in cls-deficient strains and measure restoration of phenotypes (biofilm formation, stress resistance)

  • in vivo lipid synthesis: Analyze cardiolipin production in intact cells expressing the recombinant enzyme

  • Substrate specificity tests: Screen different substrates to identify optimal conditions

What are the key experimental controls needed when studying Cardiolipin synthase function in E. coli?

Robust experimental controls are essential for reliable cardiolipin synthase research:

Genetic Controls:

  • Wild-type strain: Include the parental strain as a positive control for normal cardiolipin synthesis

  • Single deletion mutants: ΔclsA, ΔclsB, and ΔclsC to assess individual contributions

  • Complete deletion mutant: ΔclsABC as a negative control lacking all cardiolipin synthesis capacity

  • Complementation control: ΔclsABC expressing plasmid-encoded cls to verify phenotype restoration

  • Empty vector control: Strain containing expression vector without cls insert

Biochemical Assay Controls:

  • Enzyme-free reaction: To measure background or non-enzymatic formation of products

  • Heat-inactivated enzyme: To detect activity from contaminating proteins

  • Alternative substrate control: Verify substrate specificity (e.g., using mannitol in place of glycerol)

  • Known enzyme activity standard: Standardized cls preparation with defined activity

  • Endogenous enzyme activity control: Measure phosphatidylglycerol synthase (PGS) activity to ensure cls overexpression doesn't affect upstream enzymes

Physiological Controls:

  • Growth phase standardization: Compare cells at the same growth phase, as cls expression increases in stationary phase

  • Stress response controls: Include strains with disrupted Rcs pathway components when studying biofilm phenotypes

  • Media composition control: Standard growth conditions, as cardiolipin synthesis is affected by nutrient availability

Implementing these controls ensures that observed phenotypes are specifically attributable to cardiolipin synthase function rather than experimental artifacts or secondary effects.

What are the implications of Cardiolipin synthase research for understanding bacterial adaptation and antimicrobial resistance?

Research on Cardiolipin synthase opens several avenues for understanding bacterial adaptation and potentially developing novel antimicrobial approaches:

Stress Adaptation Mechanisms:

  • Cardiolipin increases during stationary phase, energy deprivation, and osmotic stress

  • Understanding cls regulation could reveal how bacteria adapt to hostile environments

  • The activation of the Rcs stress response in cardiolipin-deficient cells suggests interconnected stress adaptation networks

Biofilm Formation and Persistence:

  • Cardiolipin's role in biofilm formation suggests it could be a target for anti-biofilm strategies

  • Targeting cardiolipin synthesis might disrupt bacterial communities that contribute to persistent infections

  • The impact on flagellar expression and motility highlights potential strategies to reduce bacterial colonization

Membrane Permeability and Antimicrobial Resistance:

  • Cardiolipin affects membrane structure and potentially antimicrobial permeability

  • Surface attachment assays with antimicrobials (polymyxin B, cecropin A) show interactions between cardiolipin and antimicrobial peptides

  • Changes in membrane lipid composition could contribute to antimicrobial resistance mechanisms

Potential Research Approaches:

  • Screen for small molecule inhibitors of Cardiolipin synthase

  • Investigate temporal regulation of cls genes during infection processes

  • Explore cls inhibition as an adjuvant therapy to increase efficacy of existing antimicrobials

  • Study the evolution of cls genes across bacterial species in relation to environmental adaptation

How might structural studies of Cardiolipin synthase inform drug discovery efforts?

Structural studies of Cardiolipin synthase could significantly advance drug discovery efforts:

Key Structural Features to Target:

  • Catalytic HKD motif: All three E. coli cls enzymes contain the phospholipase D characteristic HKD motif essential for activity

  • Transmembrane domains: Critical for proper orientation and activity; swapping TMDs results in interference with CL synthesis

  • Substrate binding pockets: Differences in substrate preferences between cls enzymes suggest unique binding pocket structures

  • Enzyme flexibility: The ability of ClsA to flip its catalytic domain indicates conformational plasticity important for function

Potential Drug Discovery Approaches:

  • Structure-based design: Using crystal or cryo-EM structures to design inhibitors targeting the active site

  • Allosteric modulators: Targeting non-catalytic regions that influence enzyme conformation

  • Membrane interface inhibitors: Disrupting protein-lipid interactions important for proper positioning

  • Conformation-specific inhibitors: Molecules that lock the enzyme in inactive conformations

Comparative Structural Analysis:

  • Human cardiolipin synthase differs from bacterial enzymes, allowing for selective targeting

  • Differences between bacterial species could enable narrow-spectrum antimicrobials

  • Structural comparison of ClsA, ClsB, and ClsC could reveal isoform-specific targeting opportunities

As structural data becomes available, computational approaches like molecular dynamics simulations and virtual screening could accelerate the identification of promising lead compounds for antimicrobial development.

What emerging technologies could advance research on Cardiolipin synthase and membrane lipid dynamics?

Several cutting-edge technologies show promise for advancing Cardiolipin synthase research:

Advanced Imaging Technologies:

  • Super-resolution microscopy: Visualizing cls localization and dynamic redistribution in living bacteria at nanoscale resolution

  • Cryo-electron tomography: Capturing 3D structures of cls within the native membrane environment

  • Mass spectrometry imaging: Mapping spatial distribution of cardiolipin in bacterial membranes with high sensitivity

Protein Engineering Approaches:

  • Optogenetic control: Light-controlled cls variants to modulate activity with precise temporal control

  • FRET-based biosensors: Real-time monitoring of cls conformational changes and substrate binding

  • Split fluorescent protein complementation: Tracking cls protein-protein interactions in vivo

Lipid Analysis Innovations:

  • Advanced LC-MS/MS techniques: Improved sensitivity for detecting minor cardiolipin species and remodeling events

  • Stable isotope labeling: Tracking cardiolipin synthesis and turnover rates in living cells

  • Native mass spectrometry: Analyzing intact cls-lipid complexes to understand protein-lipid interactions

High-throughput Methods:

  • Automated protein expression systems: Platforms like APEX for high-throughput recombinant protein production

  • CRISPR-Cas9 screening: Genome-wide screens for genes that interact with cardiolipin synthesis pathways

  • Microfluidic devices: Single-cell analysis of cardiolipin content and cls activity

Computational Approaches:

  • Molecular dynamics simulations: Modeling cls-membrane interactions at atomic resolution

  • Deep learning algorithms: Predicting cls function from sequence or identifying novel inhibitors

  • Systems biology models: Integrating cardiolipin metabolism with broader cellular processes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.