Recombinant Escherichia coli O81 Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cobalamin Biosynthesis

CobS is a polytopic membrane protein critical for cobalamin synthesis. Its enzymatic activity involves:

  • Substrate specificity: CobS utilizes adenosylcobinamide-GDP (AdoCbi-GDP) and α-ribazole-5′-phosphate as substrates .

  • Catalytic mechanism: The enzyme facilitates the formation of a phosphodiester bond between AdoCbi-GDP and α-ribazole-5′-phosphate, producing AdoCbl-5′-P .

  • Dependence on CobC: The final dephosphorylation step, converting AdoCbl-5′-P to AdoCbl, requires CobC phosphatase .

Challenges in Recombinant Expression

Overexpression of CobS in E. coli strains (e.g., BL21(DE3)) poses significant challenges due to its membrane localization and cytotoxic effects:

  • Membrane instability: Elevated CobS levels dissipate the proton motive force (PMF), increasing membrane permeability and reducing cell viability .

  • Toxicity mitigation: Coexpression with cobC (phosphatase) and pspA (phage shock protein A) counteracts PMF collapse and improves membrane integrity .

Experimental Findings on CobS Overproduction

Key studies using E. coli models reveal CobS’s impact on cellular physiology:

ParameterEffect of CobS OverexpressionExperimental Evidence
PMF dissipationIncreased ethidium bromide (EtBr) uptake2.5-fold higher fluorescence in 30 min
Membrane permeabilityElevated TO-PRO-3 dye influx1.8-fold increase vs. control
Cell viability90% reduction in colony-forming units (CFU)0.5 mM IPTG induction
Rescue by CobC/PspARestored PMF and CFU countsCoexpression normalizes growth

Applications in Biotechnology

Recombinant CobS has potential uses in:

  • Vitamin B₁₂ production: Optimizing in vitro systems for industrial cobalamin synthesis .

  • Membrane protein studies: Serving as a model for polytopic enzyme behavior in lipid bilayers .

  • Synthetic biology: Engineering microbial pathways for novel cobamide derivatives .

Research Gaps and Future Directions

  • Structural data: No high-resolution structure of E. coli CobS is available, limiting mechanistic insights.

  • Strain-specific variations: The CobS sequence and function in E. coli O81 remain uncharacterized compared to K-12 or B strains .

  • Industrial scalability: Overcoming cytotoxicity during large-scale fermentation requires strain engineering .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; ECED1_2328; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG APLAALFSVLVLVLMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGESILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) catalyzes the final two steps in the biosynthesis of cobalamin (vitamin B12):
1. Joins adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin).
2. Synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin Synthase (CobS) and what role does it play in E. coli metabolism?

Cobalamin synthase (CobS) is an essential enzyme in the vitamin B12 (cobalamin) biosynthetic pathway. In E. coli, CobS catalyzes one of the final steps in cobalamin assembly, specifically the attachment of the upper axial ligand to the corrin ring structure. This enzyme is critical because cobalamin functions as a cofactor for several metabolic enzymes, including methionine synthase (MetH), which is essential for methionine synthesis .

While some laboratory strains of E. coli cannot synthesize cobalamin de novo and rely on transport systems to acquire it from the environment, other strains like E. coli O81 may possess the complete biosynthetic pathway. The cobS gene is typically part of the cob operon, which is regulated in response to cellular cobalamin levels and environmental conditions.

How can I express recombinant CobS from E. coli O81 in a laboratory setting?

Expression of recombinant CobS from E. coli O81 requires a systematic approach similar to that used for other E. coli recombinant proteins :

  • Gene cloning: Amplify the cobS gene from E. coli O81 genomic DNA using PCR with specific primers containing appropriate restriction sites. Clone the gene into an expression vector (such as pET series) with an N-terminal His-tag for purification.

  • Transformation and expression: Transform the recombinant plasmid into an E. coli expression strain such as BL21(DE3). Culture cells in LB medium at 37°C until OD600 reaches 0.6-0.8, then induce protein expression with IPTG (0.1-1.0 mM). For optimal expression, decrease the temperature to 16-25°C after induction and continue growth for 12-18 hours.

  • Cell harvesting and lysis: Harvest cells by centrifugation (5,000 × g, 15 minutes, 4°C). Resuspend in lysis buffer (typically 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole) and disrupt cells by sonication or French press.

  • Protein purification: Purify the His-tagged CobS using Ni-NTA affinity chromatography, followed by size exclusion chromatography if higher purity is required.

  • Storage: Store the purified protein in a stabilizing buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, and 6% trehalose . Aliquot and store at -80°C to prevent degradation from freeze-thaw cycles.

What assays can be used to verify the enzymatic activity of recombinant CobS?

Several complementary assays can verify the enzymatic activity of recombinant CobS:

  • HPLC-based activity assay: Monitor the conversion of the precursor molecule (hydrogenobyrinic acid a,c-diamide) to the product using HPLC separation and UV-visible detection. This assay directly quantifies substrate consumption and product formation based on their distinct retention times and spectral properties.

  • LC-MS/MS analysis: Use liquid chromatography coupled with tandem mass spectrometry to detect both the substrate and product with high sensitivity and specificity, enabling precise quantification of CobS activity even at low enzyme concentrations.

  • Coupled enzyme assay: Measure CobS activity by coupling it to methionine synthase (MetH) activity. Since MetH requires functional cobalamin as a cofactor, the rate of methionine production can indirectly reflect CobS activity .

  • Complementation assay: Transform a cobS-deficient strain with a plasmid expressing recombinant CobS and assess growth restoration under conditions requiring cobalamin synthesis.

  • Spectrophotometric assay: Monitor changes in the UV-visible absorption spectrum during the reaction, as the conversion of cobalamin precursors to complete cobalamin produces characteristic spectral shifts.

What expression systems yield the highest activity of recombinant CobS?

The optimal expression system for obtaining high-activity recombinant CobS involves several critical considerations:

  • Host strain selection: E. coli BL21(DE3) is often the preferred host due to its deficiency in lon and ompT proteases, which reduces degradation of the recombinant protein. For improved expression of proteins containing rare codons, Rosetta(DE3) may yield better results.

  • Expression vector: pET vectors with the T7 promoter system provide strong, inducible expression. Including a His-tag facilitates purification while minimally impacting enzyme activity .

  • Induction conditions: For optimal folding and activity:

    • Induce at OD600 of 0.6-0.8

    • Use moderate IPTG concentration (0.1-0.5 mM)

    • Reduce temperature to 16-18°C post-induction

    • Extend expression time to 16-24 hours

  • Co-expression strategies: Co-expressing molecular chaperones (GroEL/GroES) can significantly improve the yield of correctly folded, active CobS.

  • Media composition: Supplementing growth media with the relevant metal cofactors required for CobS activity can improve the proportion of active enzyme in the final preparation.

A systematic comparison of expression conditions using a fractional factorial design approach is recommended to identify the optimal combination of these parameters for maximal CobS activity.

How does environmental availability of cobamides influence the expression and activity of CobS in E. coli?

The environmental availability of cobamides significantly impacts CobS expression and activity through sophisticated regulatory mechanisms:

  • Transcriptional regulation: When environmental cobamides are abundant, E. coli downregulates the transcription of cobS and other genes in the cobalamin synthesis pathway through negative feedback mechanisms. Conversely, cobamide limitation triggers increased expression of these genes.

  • Enzyme adaptation: Laboratory evolution experiments with E. coli grown under cobamide-limiting conditions have shown that mutations can arise that optimize the use of less-preferred cobamides . Similar adaptive mechanisms may affect CobS activity to accommodate structural variations in available cobamide precursors.

  • Transport system coordination: Under cobamide limitation, E. coli upregulates expression of the outer membrane cobamide transporter BtuB . This coordination between transport and biosynthesis pathways ensures efficient cobamide utilization.

  • Post-translational regulation: CobS activity may be directly modulated by the cellular cobamide pool through allosteric mechanisms or post-translational modifications.

  • Metabolic integration: The activity of CobS is integrated with methionine synthesis through MetH, which requires adenosylated cobamides for optimal function . This integration ensures that cobalamin synthesis matches cellular metabolic needs.

These regulatory mechanisms enable E. coli to balance the energetically expensive process of de novo cobalamin synthesis with the utilization of environmentally available cobamides.

What genetic adaptations might influence CobS efficiency during laboratory evolution experiments with E. coli O81?

Laboratory evolution experiments with E. coli under selective pressure for improved cobalamin synthesis could yield several types of genetic adaptations affecting CobS efficiency:

  • Promoter mutations: Changes in the promoter region of the cobS gene could increase expression levels, similar to mutations that enhanced expression of the BtuB transporter observed in laboratory evolution experiments with cobamide-dependent E. coli strains .

  • Coding sequence mutations: Specific amino acid substitutions in CobS could enhance its:

    • Catalytic efficiency (kcat)

    • Substrate binding affinity (Km)

    • Thermostability

    • Tolerance for structural variations in substrates

  • Regulatory adaptations: Mutations in transcription factors or RNA elements that regulate cobS expression could optimize its production in response to cellular needs.

  • Pathway rebalancing: Adaptations in genes encoding other enzymes in the cobalamin synthesis pathway might optimize metabolic flux toward cobalamin production.

  • Global regulatory changes: Mutations affecting global regulatory systems could indirectly enhance CobS efficiency by altering cellular metabolism or stress responses.

The laboratory evolution approach described for E. coli adaptation to pseudocobalamin provides a methodological template for identifying such adaptations . Whole-genome sequencing of evolved strains, followed by reconstruction of identified mutations, would confirm their specific effects on CobS efficiency.

How can researchers distinguish between different evolutionary lineages of CobS in E. coli strains?

Distinguishing evolutionary lineages of CobS in E. coli strains requires a multifaceted approach:

  • Single nucleotide polymorphism (SNP) analysis: Similar to the rpoB SNP haplotype analysis used to trace the evolutionary pathways of E. coli strains , researchers can identify and classify distinctive SNP patterns in the cobS gene. This approach could reveal specific evolutionary trajectories of CobS.

  • Network analysis: Building a network based on the SNPs in cobS genes from different E. coli strains can visualize evolutionary relationships . This method can identify major lineages and suggest progenitor-progeny relationships.

  • Phylogenetic reconstruction: Bayesian inference or maximum likelihood methods applied to cobS sequences can generate phylogenetic trees that illustrate the evolutionary history of this gene across E. coli strains.

  • Comparative genomic context: Analyzing the genetic context surrounding cobS can provide additional insights into evolutionary history, as gene arrangements and proximal genetic elements often co-evolve.

  • Functional classification: Biochemical characterization of CobS variants from different lineages can reveal functional differences that correlate with evolutionary divergence.

This multi-layered approach, similar to the evolutionary tracing conducted for 3029 E. coli strains based on rpoB SNP haplotypes , would provide a comprehensive view of CobS evolution across the E. coli species complex.

What is the relationship between CobS and adenosyltransferase activity in optimizing cobalamin-dependent metabolism?

The relationship between CobS and adenosyltransferase activity represents a critical aspect of cobalamin metabolism optimization:

  • Functional synergy: Laboratory evolution experiments with E. coli revealed that overexpression of the cobamide adenosyltransferase BtuR confers a specific growth advantage when cells utilize pseudocobalamin (pCbl) . This suggests that CobS-produced cobalamin must be properly adenosylated for optimal function.

  • Metabolic integration: The adenosylation of cobamides is essential for their function in certain enzymatic reactions. For methionine synthase (MetH)-dependent growth, adenosylated cobamides contribute to optimal enzyme activity , linking CobS activity directly to downstream metabolic processes.

  • Regulatory coordination: The expression and activity of CobS and adenosyltransferases like BtuR appear to be coordinated to ensure the production of functionally complete cobalamin cofactors.

  • Structural considerations: The structural modifications introduced by adenosyltransferases affect how effectively the cobalamin molecule interacts with target enzymes, suggesting a functional evolutionary relationship between CobS product specificity and adenosyltransferase activity.

  • Adaptation mechanisms: In environments with structurally diverse cobamides, the coordinated adaptation of both CobS and adenosyltransferases might enhance bacterial metabolic flexibility.

This relationship highlights the importance of considering the entire pathway from cobalamin synthesis through activation to utilization when studying CobS function and evolution.

What are the optimal conditions for purifying active recombinant CobS from E. coli O81?

The purification of active recombinant CobS requires careful optimization of multiple parameters:

  • Lysis buffer composition:

    • 50 mM Tris-HCl, pH 8.0

    • 300 mM NaCl

    • 10 mM imidazole

    • 5% glycerol

    • 1 mM DTT (to maintain reducing conditions)

    • Complete protease inhibitor cocktail

  • Chromatography strategy:

    • Primary purification: Ni-NTA affinity chromatography

      • Binding buffer: Same as lysis buffer

      • Wash buffer: Lysis buffer with 20-30 mM imidazole

      • Elution buffer: Lysis buffer with 250-300 mM imidazole

    • Secondary purification: Size exclusion chromatography

      • Buffer: 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 5% glycerol

  • Critical considerations:

    • Maintain temperature at 4°C throughout purification

    • Add freshly prepared DTT immediately before use

    • Collect fractions and assess purity by SDS-PAGE

    • Test activity in fractions to track enzyme functionality

    • Concentrate using centrifugal filters with appropriate MWCO

  • Final storage:

    • Storage buffer: 50 mM Tris/PBS-based buffer, pH 8.0 with 6% trehalose as a stabilizing agent

    • Aliquot in small volumes to avoid repeated freeze-thaw cycles

    • Flash-freeze in liquid nitrogen and store at -80°C

    • For extended stability, add additional glycerol to 20-25% final concentration

This optimized protocol, adapted from successful approaches used for other E. coli recombinant proteins , provides a framework that can be further refined based on specific properties of CobS.

How can researchers troubleshoot expression issues with recombinant CobS in E. coli systems?

When encountering challenges with CobS expression, researchers should systematically address potential issues:

  • Low expression levels:

    • Verify vector sequence and reading frame

    • Optimize codon usage for E. coli expression

    • Test different expression strains (BL21, Rosetta, Arctic Express)

    • Evaluate alternative promoters or ribosome binding sites

    • Create fusion constructs with well-expressed partner proteins

  • Protein insolubility:

    • Reduce expression temperature to 16-20°C

    • Decrease inducer concentration (0.01-0.1 mM IPTG)

    • Co-express with molecular chaperones

    • Add solubility-enhancing fusion tags (MBP, SUMO, TrxA)

    • Optimize lysis buffer composition (add detergents, adjust salt concentration)

  • Protein instability:

    • Include protease inhibitors during all purification steps

    • Test expression in protease-deficient strains

    • Identify and modify protease-sensitive regions

    • Add stabilizing agents like trehalose (6%) to storage buffer

    • Avoid repeated freeze-thaw cycles by using small aliquots

  • Loss of activity:

    • Ensure all required cofactors are present during activity assays

    • Test effect of tag position (N-terminal vs. C-terminal)

    • Consider tag removal if it interferes with activity

    • Optimize buffer conditions for stability and activity

    • Verify proper folding using circular dichroism spectroscopy

Each troubleshooting approach should be systematically documented and assessed for its impact on protein yield, purity, and activity to identify the most effective combination of conditions.

What analytical techniques are most effective for characterizing the structure-function relationship of recombinant CobS?

A comprehensive characterization of CobS structure-function relationships requires multiple complementary analytical techniques:

This integrated approach enables researchers to connect specific structural features of CobS to its enzymatic function, providing insights for protein engineering and understanding evolutionarily conserved features.

What in silico methods can predict the impact of mutations on CobS activity?

In silico methods offer powerful approaches to predict how mutations might affect CobS activity:

  • Sequence-based prediction tools:

    • Evolutionary conservation analysis: Identifies functionally critical residues using ConSurf or similar tools

    • Sequence-based stability predictors: PROVEAN, SIFT, and PolyPhen-2 estimate the functional impact of mutations

    • Coevolution analysis: Methods like Direct Coupling Analysis detect pairs of residues that evolved together, suggesting functional relationships

  • Structure-based computational methods:

    • Energy calculation algorithms: FoldX, Rosetta, and CUPSAT predict changes in protein stability upon mutation

    • Molecular dynamics simulations: Assess how mutations affect protein dynamics and flexibility

    • Active site volume calculations: Predict how mutations might alter substrate accessibility or binding

  • Integrated prediction frameworks:

    • Machine learning approaches: Combine multiple features to predict mutation effects

    • SDM (Site-Directed Mutator): Predicts stability changes based on environment-specific substitution tables

    • mCSM: Uses graph-based signatures to predict mutation effects on stability and function

  • Application to CobS-specific questions:

    • Virtual screening of potential mutations at the active site

    • Rational design of mutations to alter substrate specificity

    • Prediction of compensatory mutations that might restore function

    • Identification of mutation hotspots that could emerge during laboratory evolution

These computational tools provide a rational basis for experimental design, helping researchers prioritize which mutations to introduce and test empirically for their effects on CobS activity and stability.

How might genetic diversity in E. coli O81 strains impact the function and evolution of CobS?

The genetic diversity observed across E. coli strains has significant implications for CobS function and evolution:

  • Sequence variations:

    • Natural polymorphisms in cobS may affect enzyme efficiency, substrate specificity, or stability

    • Variations in regulatory regions could alter expression patterns in response to environmental conditions

    • Different E. coli lineages may show distinct patterns of cobS evolution, similar to the evolutionarily distinct RST classifications observed for other genes

  • Evolutionary drivers:

    • Adaptation to different ecological niches with varying cobamide availability

    • Co-evolution with other components of the cobalamin synthesis pathway

    • Selection pressure from competition for limited cobamides in specific environments

  • Functional impacts:

    • Strain-specific differences in cobalamin synthesis efficiency

    • Variation in ability to utilize different cobamide precursors

    • Differentially optimized CobS variants for specific environmental conditions

  • Research approaches to explore this diversity:

    • Comparative genomics analysis of cobS across E. coli strains

    • Reconstruction of evolutionary history using network analysis methods

    • Functional characterization of CobS variants from different lineages

    • Exploration of the correlation between cobS variants and ecological niches

Understanding this diversity could reveal how CobS has evolved to meet specific metabolic demands in different E. coli lineages, similar to how the RNA polymerase beta subunit gene has been used to trace evolutionary pathways .

What are the implications of cobamide structural diversity for CobS substrate specificity and enzyme engineering?

The structural diversity of natural cobamides presents both challenges and opportunities for understanding and engineering CobS:

  • Natural substrate diversity:

    • Cobamides differ in their lower axial ligand structures

    • E. coli can adapt to utilize less-preferred cobamides like pseudocobalamin (pCbl)

    • CobS may have evolved substrate preferences reflecting environmental cobamide availability

  • Enzyme engineering potential:

    • Directed evolution approaches can yield CobS variants with altered substrate specificity

    • Rational design based on structural understanding of substrate binding could enhance activity

    • Chimeric enzymes combining domains from different species might create novel specificities

  • Biotechnological applications:

    • Production of novel cobalamin analogs with enhanced properties

    • Development of optimized biocatalysts for specific industrial processes

    • Creation of biosensors for detecting specific cobamide structures

  • Research priorities:

    • Structural characterization of CobS-substrate complexes

    • Systematic analysis of substrate specificity across natural CobS variants

    • High-throughput screening methods for evolved CobS variants

    • Computational modeling of substrate binding and catalysis

The laboratory evolution of E. coli with pseudocobalamin demonstrates the adaptive potential for improved growth with less-preferred cobamides , suggesting similar approaches could yield CobS variants with enhanced or altered activities.

How can systems biology approaches enhance our understanding of CobS function within the context of cellular metabolism?

Systems biology offers powerful frameworks to contextualize CobS function within E. coli metabolism:

  • Multi-omics integration:

    • Transcriptomics: Reveals co-expression patterns of cobS with other genes under various conditions

    • Proteomics: Quantifies changes in CobS abundance and post-translational modifications

    • Metabolomics: Measures levels of cobalamin intermediates and products

    • Fluxomics: Determines metabolic flux through the cobalamin synthesis pathway

  • Network analysis:

    • Protein-protein interaction networks identify CobS binding partners

    • Gene regulatory networks reveal transcriptional control mechanisms

    • Metabolic networks position cobalamin synthesis within global metabolism

    • Evolutionary networks trace how CobS co-evolves with interacting proteins

  • Genome-scale modeling:

    • Integration of cobalamin synthesis into genome-scale metabolic models

    • Flux balance analysis to predict effects of cobS mutations

    • Simulation of metabolic responses to varying cobamide availability

    • Identification of synthetic lethal interactions involving cobS

  • Applications:

    • Prediction of metabolic bottlenecks in cobalamin synthesis

    • Design of optimized strains for cobalamin production

    • Understanding how cobalamin metabolism integrates with global cellular processes

    • Identification of potential drug targets in pathogenic strains

These systems approaches can reveal emergent properties not apparent from studying CobS in isolation, similar to how network analysis has provided insights into E. coli evolution .

What methodological advances are needed to better understand the kinetic parameters of CobS-catalyzed reactions?

Advancing our understanding of CobS kinetics requires several methodological improvements:

  • Substrate availability challenges:

    • Development of synthetic routes to produce cobalamin precursors in sufficient quantity and purity

    • Creation of modified substrates with detection tags or altered properties for mechanistic studies

    • Establishment of substrate analog libraries to probe specificity determinants

  • Advanced kinetic analysis techniques:

    • Pre-steady-state kinetics using stopped-flow or quench-flow methods to resolve individual steps

    • Single-molecule approaches to detect conformational changes during catalysis

    • Isotope-labeling strategies to track atom transfer during the reaction

    • Temperature-jump experiments to measure activation parameters

  • Technological developments:

    • High-throughput activity assays for rapid screening of mutant libraries

    • Label-free detection methods to monitor reaction progress in real-time

    • Microfluidic platforms for precise control of reaction conditions

    • In-cell NMR to observe CobS behavior in its native environment

  • Computational approaches:

    • Quantum mechanics/molecular mechanics (QM/MM) simulations of the reaction mechanism

    • Machine learning models to predict kinetic parameters based on sequence or structure

    • Kinetic modeling frameworks to integrate CobS activity into pathway-level simulations

These methodological advances would enable researchers to move beyond simple steady-state kinetics to develop detailed mechanistic models of CobS function, similar to the in-depth understanding achieved for other enzymes in complex biosynthetic pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.