Recombinant Escherichia coli O81 Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Functional Role in E. coli and Bacterial Energy Metabolism

The Rnf complex, including RnfE, serves as a transhydrogenase in anaerobic bacteria, linking ferredoxin and NAD⁺ pools. It operates bidirectionally:

  • Forward Direction: Transfers electrons from ferredoxin to NAD⁺, generating a proton gradient for ATP synthesis during autotrophic growth .

  • Reverse Direction: Reduces ferredoxin using NADH, enabling carbon fixation and biosynthesis under low-energy conditions .

Key Findings from Acetobacterium woodii Studies:

  • Rnf mutants fail to grow autotrophically or on low-energy substrates, underscoring its essential role in energy conservation .

  • The complex translocates Na⁺ or H⁺ ions, depending on the organism, coupling electron transfer to ion gradients .

Recombinant Production in E. coli

RnfE is expressed in E. coli using optimized systems to maximize yield and solubility.

Expression Systems and Strains:

StrainGenotype/FeaturesApplication for RnfE Production
BL21(DE3)T7 RNAP-controlled expression; protease-deficient (Lon/OmpT⁻) High-yield expression; risk of toxicity
BL21Star(DE3)rne131 mutation stabilizes mRNA; increased expression Enhanced stability for RnfE
Origami(DE3)trxB/gor mutations; enables cytoplasmic disulfide bond formation Critical for proper folding of RnfE
Rosetta(DE3)Carries rare tRNA genes; supports codon-biased sequences Overcomes rare codon limitations in RnfE

Optimization Strategies:

  • Codon Bias Adjustment: Rare codons in the 5′ region reduced expression by ~14-fold; optimization improved yields .

  • Chaperones/Coexpression: Disulfide bond formation requires trxB/gor mutations .

Purification and Quality Control

RnfE is purified via affinity chromatography (His-tag) and validated through SDS-PAGE and functional assays.

Purification Workflow:

  1. Lysis: Cell disruption under native conditions.

  2. Nickel-NTA Affinity Chromatography: Captures His-tagged RnfE.

  3. SDS-PAGE: Confirms >90% purity .

Storage Conditions:

ParameterRecommendation
FormLyophilized or liquid (Tris/PBS buffer with 50% glycerol)
Temperature-20°C/-80°C for long-term storage; 4°C for short-term aliquots
StabilityAvoid freeze-thaw cycles; shelf life: 6–12 months

Applications in Research and Biotechnology

RnfE is used in:

  • Biocatalysis: Engineering redox pathways for biofuel production or CO₂ fixation.

  • Structural Studies: Cryo-EM or X-ray crystallography to elucidate Rnf complex architecture.

  • Diagnostics: Western blotting (WB) or ELISA for detecting RnfE in bacterial lysates .

Commercial Products:

VendorProduct CodePurityApplications
Creative BiomartRFL12003EF>90%Structural studies
AvivaSysBioOPCA155163>85%WB/ELISA
MyBioSourceN/A>85%Biochemical assays

Research Challenges and Future Directions

  • Solubility Issues: RnfE’s membrane-bound nature often leads to aggregation; coexpression with chaperones (e.g., GroEL) may improve folding .

  • Post-Translational Modifications: E. coli lacks glycosylation machinery; coexpression with eukaryotic enzymes could expand functional studies .

  • Industrial Scalability: High-throughput screens for optimal strains and induction conditions are needed to reduce production costs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rsxE; ECED1_1833; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
rsxE
Target Protein Sequence
MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDEKMKKRRTEAAAERALPNGETGNV
Uniprot No.

Target Background

Function
A component of a membrane-bound complex that couples electron transfer with ion translocation across the membrane. It is essential for maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Escherichia coli O81 Electron transport complex protein RnfE (rnfE)?

RnfE is a membrane-bound component of the Rnf complex, functioning as part of a ferredoxin:NAD+ oxidoreductase system that couples electron transfer to ion translocation. This 231-amino acid protein (UniProt ID: B7MVB0) is also known as rsxE, ECED1_1833, or ion-translocating oxidoreductase complex subunit E . The Rnf complex as a whole energetically couples the cellular ferredoxin to the pyridine nucleotide pool, operating in the redox range more negative than -320 mV, which has historically been less extensively studied . In E. coli, RnfE contributes to the electron transport capabilities essential for various redox-dependent metabolic processes.

How does the Rnf complex contribute to microbial bioenergetics?

The Rnf complex represents an important but previously underappreciated component of microbial energy conservation strategies. Unlike classic respiratory chains that span from NADH to oxygen, the Rnf complex operates in the more negative redox range, coupling ferredoxin oxidation to NAD+ reduction . This electron transfer is coupled to ion translocation (typically Na+ or H+) across the membrane, generating an electrochemical gradient that can drive ATP synthesis or other energy-requiring processes.

In Acetobacterium woodii, studies with inverted membrane vesicles demonstrated that the ferredoxin:NAD+ oxidoreductase activity catalyzes primary Na+ transport, with electron flow from reduced ferredoxin to NAD+ energizing this process . This Na+ transport was shown to be electrogenic and specifically inhibited by the Na+ ionophore ETH2120, confirming its primary nature. The Rnf complex thus provides an alternative mechanism for energy conservation in diverse microorganisms, particularly those adapted to anaerobic environments.

What are the optimal expression systems for recombinant RnfE production?

For successful recombinant RnfE expression, researchers should consider specialized approaches for membrane proteins:

Expression Systems:

  • E. coli-based expression: Despite being a native E. coli protein, recombinant RnfE expression benefits from specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression

  • Expression vectors: pET-based systems with T7 promoters provide controllable, high-level expression with appropriate fusion tags (typically His-tags) for purification

  • Induction conditions: Lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM) often improve properly folded membrane protein yields

The challenges with RnfE expression mirror those of other membrane proteins, where protein toxicity, misfolding, and aggregation must be carefully managed. Codon optimization and fusion partners like MBP or SUMO can sometimes enhance expression and solubility. For complex functional studies requiring the complete Rnf complex, co-expression of multiple subunits may be necessary to achieve proper assembly and functionality.

What purification strategy yields the highest purity and activity for RnfE?

Purification of recombinant RnfE requires a specialized approach for membrane proteins:

Optimized Purification Protocol:

  • Membrane isolation: Following cell lysis, differential centrifugation separates membrane fractions containing RnfE

  • Detergent solubilization: Carefully selected detergents (typically n-dodecyl-β-D-maltopyranoside or n-octyl-β-D-glucopyranoside) extract RnfE while maintaining native structure

  • Affinity chromatography: For His-tagged constructs, immobilized metal affinity chromatography using Ni-NTA resins with detergent-containing buffers provides initial purification

  • Size exclusion chromatography: Further purification and assessment of oligomeric state in detergent micelles

  • Stability enhancement: Including 6% trehalose and appropriate detergent concentrations maintains protein integrity during storage

The purification buffer typically contains 50 mM Tris-HCl (pH 8.0), 150-300 mM NaCl, detergent at concentrations above its critical micelle concentration, and possibly glycerol (10-20%) to enhance stability . Reducing agents like DTT or TCEP (1-5 mM) help prevent oxidation of cysteine residues that might form inappropriate disulfide bonds.

How can researchers verify proper folding and membrane integration of recombinant RnfE?

Verifying proper folding and membrane integration is critical before functional studies:

Structural Verification Methods:

  • SDS-PAGE and Western blotting: Confirms appropriate molecular weight (~26 kDa plus tag size) and immunoreactivity

  • Membrane fractionation analysis: RnfE should segregate predominantly with membrane fractions

  • Circular dichroism spectroscopy: Properly folded RnfE should show spectra consistent with predicted secondary structure elements

  • Limited proteolysis: Folded proteins show distinct proteolytic patterns compared to misfolded variants

  • Thermal shift assays: Measure protein stability under different conditions to optimize buffers

Functional Verification Methods:

  • Reconstitution into liposomes: Confirm membrane integration through proteoliposome formation

  • Electron transfer activity: Using artificial electron donors/acceptors in reconstituted systems

  • Complex assembly analysis: Co-purification with other Rnf components indicates proper folding compatible with complex formation

Researchers should always prepare multiple protein batches and verify consistent behavior across preparations to ensure reproducibility and rule out preparation artifacts.

What methods are used to measure the electron transport activity of the Rnf complex containing RnfE?

The electron transport function of the Rnf complex can be assessed through several complementary approaches:

Electron Transport Assay Methods:

  • Spectrophotometric assays: Monitor NAD+ reduction (at 340 nm) in the presence of reduced ferredoxin and purified Rnf complex components

  • Artificial electron donor/acceptor systems: Using methyl viologen or benzyl viologen as electron donors and NAD+ as the acceptor

  • Oxygen-sensitive measurements: Performed in anaerobic chambers or sealed cuvettes to prevent oxidation of reduced ferredoxin

  • Reconstituted systems: Incorporating purified RnfE (and other Rnf components) into liposomes to measure vectorial electron transport

Data Analysis and Controls:

  • Comparison of rates with and without RnfE to determine its specific contribution

  • Measurement of activity across a range of substrate concentrations to determine kinetic parameters

  • Inclusion of ionophores to assess coupling between electron transport and ion translocation

The membrane-bound ferredoxin:NAD+ oxidoreductase activity catalyzed by the Rnf complex couples electron flow with Na+ or H+ translocation, making it essential to correlate electron transport measurements with ion movement studies for complete functional characterization .

How can researchers measure Na+ translocation associated with RnfE activity?

Studies with the Rnf complex have demonstrated Na+ translocation coupled to ferredoxin:NAD+ oxidoreductase activity:

Na+ Translocation Measurement Techniques:

  • Radioisotope flux measurements: Using 22Na+ to directly track ion movement, as demonstrated with inverted membrane vesicles from A. woodii

  • Na+-selective electrodes: For continuous monitoring of Na+ concentration changes

  • Fluorescent indicators: Indirect measurement of ion gradients using membrane potential-sensitive dyes

  • Inverted membrane vesicle preparation: Critical for orientation-specific studies of ion translocation

Essential Experimental Controls:

  • Addition of the Na+ ionophore ETH2120 should collapse Na+ gradients, confirming specificity

  • Protonophores should not affect Na+ transport if the system is Na+-specific

  • Electron transport inhibitors should prevent Na+ translocation if properly coupled

In A. woodii, studies showed that 22Na+ transport was dependent on both NAD+ as electron acceptor and reduced ferredoxin (generated with titanium (III) citrate) as electron donor, demonstrating the coupling between electron transfer and ion translocation .

How can researchers design structure-function studies to understand RnfE mechanisms?

Detailed structure-function analysis of RnfE requires a multifaceted approach:

Structure-Function Analysis Methods:

  • Systematic mutagenesis:

    • Alanine scanning of conserved residues in transmembrane regions

    • Charge-swap mutations to identify ion coordination sites

    • Conservative vs. non-conservative substitutions to determine functional tolerance

  • Chimeric protein construction:

    • Domain swapping with homologous proteins from Na+- vs. H+-translocating Rnf complexes

    • Creation of fusion constructs to probe topology and domain organization

  • Biophysical characterization:

    • Hydrogen-deuterium exchange mass spectrometry to identify solvent-accessible regions

    • Site-directed spin labeling combined with EPR to measure distances between labeled sites

    • Single-molecule FRET to detect conformational changes during the transport cycle

  • Computational approaches:

    • Homology modeling based on related ion transporters

    • Molecular dynamics simulations to identify ion permeation pathways

    • Quantum mechanical calculations for electron transfer pathway identification

These approaches should be integrated with functional assays measuring both electron transport and ion translocation activities to correlate structural features with specific mechanistic steps.

How do mutations in RnfE affect the function of the Rnf complex?

Analysis of mutations provides critical insights into RnfE function within the Rnf complex:

Mutation Impact Assessment:

Mutation TargetExpected EffectFunctional AssayStructural Verification
Conserved charged residues in transmembrane domainsAltered ion selectivity or transportNa+/H+ transport assaysCD spectroscopy to confirm folding
Proposed electron transfer residuesReduced electron transport rateFerredoxin:NAD+ oxidoreductase activityEPR spectroscopy
Interface residues with other Rnf subunitsDisrupted complex assemblyCo-purification analysisSize exclusion chromatography
C-terminal domainAltered regulation or coupling efficiencyKinetic analysis under varying conditionsLimited proteolysis

When designing mutation studies, researchers should:

  • Consider evolutionary conservation across species to identify functionally critical residues

  • Verify that mutations do not simply cause protein misfolding or degradation

  • Examine both electron transport and ion translocation to identify coupling defects

  • Use complementation of knockout strains to verify in vivo significance

How can the Rnf complex be leveraged for synthetic biology applications?

The unique properties of the Rnf complex offer several opportunities for synthetic biology:

Synthetic Biology Applications:

  • Metabolic engineering:

    • Introduction of the Rnf complex into non-native hosts to enhance energy conservation during fermentation

    • Coupling the Rnf complex to novel metabolic pathways to improve redox balance

    • Engineering ferredoxin-dependent pathways in industrial microorganisms

  • Bioelectrochemical systems:

    • Developing microbial fuel cells with enhanced electron transfer capabilities

    • Creating biosensors based on electron transfer to electrodes

    • Constructing artificial electron transport chains with novel properties

  • Design strategies:

    • Rational protein engineering to alter ion specificity (Na+ vs. H+)

    • Directed evolution to optimize activity under specific conditions

    • Construction of minimal synthetic Rnf complexes with reduced complexity

The Rnf complex represents a promising module for synthetic biology due to its ability to couple the low-potential ferredoxin pool to the NAD+/NADH pool while generating an ion gradient. This dual function could be particularly valuable in engineering anaerobic production strains where energy conservation is challenging.

What are common pitfalls in expression and purification of RnfE?

Researchers face several challenges when working with RnfE and other membrane proteins:

Common Challenges and Solutions:

  • Low expression yield:

    • Problem: Membrane proteins often express poorly in heterologous systems

    • Solutions: Lower induction temperature (16-20°C), specialized E. coli strains (C41/C43), co-expression with chaperones, optimized codon usage

  • Protein aggregation:

    • Problem: Formation of inclusion bodies or non-functional aggregates

    • Solutions: Reduce expression rate, add solubilizing agents (glycerol), optimize detergent selection for extraction

  • Loss of activity during purification:

    • Problem: Denaturation during membrane extraction

    • Solutions: Screen multiple detergents, include stabilizing lipids, maintain cold temperatures throughout purification

  • Incomplete complex assembly:

    • Problem: RnfE purified alone may not reflect native structure/function

    • Solutions: Co-expression with other Rnf subunits, reconstitution experiments with purified components

When designing purification protocols, researchers should include quality control steps after each stage to monitor protein integrity, using techniques like SDS-PAGE, size exclusion chromatography, and activity assays with appropriate controls.

What controls are essential for validating RnfE functional assays?

Robust experimental design requires appropriate controls to ensure reliable results:

Essential Controls for RnfE Functional Assays:

  • Negative controls:

    • Heat-inactivated RnfE to distinguish enzymatic from non-enzymatic activities

    • Reactions lacking essential substrates (ferredoxin or NAD+)

    • Detergent-solubilized membranes from cells without RnfE expression

  • Specificity controls:

    • Addition of ionophores (ETH2120 for Na+, CCCP for H+) to collapse ion gradients

    • Alternative electron donors/acceptors to verify substrate specificity

    • Inhibitors of related electron transport components

  • Validation controls:

    • Concentration dependence to establish linearity of assay

    • Time-course measurements to ensure steady-state conditions

    • Comparison of multiple measurement techniques for cross-validation

  • Technical replicates:

    • Biological replicates from independent protein preparations

    • Technical replicates to establish measurement precision

    • Positive controls with known activity for inter-assay calibration

Researchers studying the Rnf complex should particularly note that the Na+ transport observed in A. woodii was dependent on both NAD+ as electron acceptor and ferredoxin/titanium(III) citrate as electron donor, and was specifically inhibited by the Na+ ionophore ETH2120 but not by protonophores .

How can researchers distinguish between effects on RnfE versus the complete Rnf complex?

Strategies for Component-Specific Analysis:

  • Reconstitution experiments:

    • Compare activities of complexes reconstituted with and without RnfE

    • Introduce site-directed RnfE variants into reconstituted complexes

    • Measure activity as a function of RnfE concentration in reconstitution mixtures

  • Complementation studies:

    • Express wild-type or mutant RnfE in RnfE-deficient strains

    • Assess restoration of complex assembly and function

    • Analyze growth phenotypes under conditions requiring Rnf activity

  • Interaction mapping:

    • Use crosslinking and mass spectrometry to identify RnfE interaction partners

    • Employ pull-down assays to determine which components directly interact with RnfE

    • Assess the impact of RnfE mutations on interactions with other complex components

  • In situ localization:

    • Fluorescent protein fusions to track RnfE localization and complex assembly

    • Co-localization studies with other Rnf components

    • FRET-based approaches to measure proximity to other subunits

When interpreting results, researchers should consider that the Rnf complex functions as an integrated unit, and perturbations to RnfE may have indirect effects on other components, making it challenging to isolate component-specific functions without carefully designed control experiments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.