Recombinant Escherichia coli O81 Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your consideration.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
frdC; ECED1_4941; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF VDFLQNPVIMIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized during anaerobic growth, while succinate dehydrogenase functions in aerobic growth. FrdC anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the composition of the E. coli fumarate reductase complex?

The E. coli fumarate reductase enzyme is encoded by the frdABCD operon and consists of four distinct subunits. The catalytic portion comprises the FrdA (flavoprotein) and FrdB (iron-sulfur protein) subunits, which form a functional dimer capable of catalyzing electron transfer reactions. The membrane anchor consists of FrdC and FrdD subunits, which are essential for membrane association and interaction with quinone electron carriers. The complete enzyme complex is required for anaerobic respiration with fumarate as the terminal electron acceptor .

What is the specific role of the FrdC subunit in fumarate reductase function?

FrdC serves as one of the two membrane anchor subunits of the fumarate reductase complex. Research demonstrates that FrdC is essential for proper membrane association of the enzyme and, critically, for the oxidation of reduced quinone analogues. Without FrdC, the catalytic dimer (FrdA-FrdB) cannot properly interact with the membrane or participate in the electron transport chain during anaerobic respiration. Experimental evidence shows that both FrdC and FrdD are required for fumarate reductase complex assembly and function, as introduction of all four fumarate reductase subunits into an E. coli strain lacking the chromosomal frd operon is essential for restoration of anaerobic growth on glycerol and fumarate .

How does the expression of frdC differ between aerobic and anaerobic conditions?

The frdABCD operon, which includes frdC, demonstrates significant expression regulation based on oxygen availability. Under anaerobic conditions, frdABCD expression levels increase more than 10-fold compared to aerobic conditions. This regulation is primarily controlled by two cellular regulatory proteins: ArcA and Fnr. These transcription factors respond to aerobic-anaerobic conditions and components of the cellular growth medium. The increased expression of frdC and other fumarate reductase subunits under anaerobic conditions enables E. coli to efficiently utilize fumarate as a terminal electron acceptor when oxygen is unavailable .

What are the recommended protocols for creating recombinant E. coli strains expressing modified frdC?

Creating recombinant E. coli strains with modified frdC involves several critical steps. First, PCR amplification of the frdC gene should be performed using high-fidelity DNA polymerase with primers containing appropriate restriction sites for subsequent cloning. The amplified product should be digested with suitable restriction enzymes and ligated into an expression vector under control of an inducible promoter.

A methodology analogous to that used for the sdhCDAB operon can be applied:

  • Design PCR primers with 5' extensions containing desired restriction sites (e.g., EcoRI)

  • Amplify the target sequence containing frdC from genomic DNA

  • Perform restriction digestion of both the PCR product and the destination vector

  • Ligate the digested PCR product into the vector

  • Transform the ligation product into a suitable E. coli host strain (preferably one lacking endogenous fumarate reductase activity)

  • Select transformants on appropriate antibiotics

  • Verify correct insertion by sequencing

  • Test expression under both aerobic and anaerobic conditions

Note that to ensure proper assembly and function of the entire complex, it may be necessary to clone and express the complete frdABCD operon rather than frdC alone.

What growth conditions are optimal for studying recombinant FrdC function in E. coli?

For studying recombinant FrdC function in E. coli, anaerobic growth conditions with glycerol as a carbon source and fumarate as the terminal electron acceptor are optimal. Based on established protocols, the following specific conditions are recommended:

  • Initial culture: Grow cells overnight in Luria-Bertani medium with appropriate antibiotics.

  • Inoculation: Dilute the overnight culture 1:500 into anaerobic minimal medium.

  • Growth vessel: Use 1-liter sealed bottles filled completely with medium to ensure anaerobic conditions.

  • Medium composition: Minimal glycerol-fumarate medium supplemented with 0.05% (wt/vol) Casamino Acids.

  • Substrate concentrations: Use 25 mM concentrations for both fumarate and glycerol.

  • Temperature: Maintain at 37°C with constant moderate stirring.

  • Monitoring: Track growth by measuring optical density at 600 nm using a spectrophotometer.

  • Antibiotic selection: Include appropriate antibiotics (e.g., 100 μg/ml ampicillin) to maintain plasmids .

These conditions ensure that fumarate reductase activity is essential for growth, providing a clear phenotypic readout of functional enzyme activity.

What assays can be used to measure FrdC activity in membrane preparations?

  • Quinone Reduction Assay: This assay measures the rate of oxidation of reduced quinone analogues (such as menaquinol) coupled to fumarate reduction. The reaction can be followed spectrophotometrically by monitoring the decrease in absorbance of the reduced quinone.

  • Membrane Association Assay: Differential centrifugation followed by Western blotting can determine whether FrdA and FrdB subunits are properly associated with the membrane fraction, which depends on functional FrdC and FrdD.

  • Fumarate Reductase Activity in Intact Membranes: Measure the rate of fumarate reduction using artificial electron donors like benzyl viologen. While the FrdA-FrdB dimer alone can catalyze this reaction, comparison between soluble and membrane fractions provides insight into proper assembly.

  • Anaerobic Growth Complementation: Introduction of plasmids expressing wild-type or mutant frdC into an frd-deficient strain allows assessment of function through growth rate measurements under anaerobic conditions with fumarate as terminal electron acceptor .

How do mutations in conserved residues of FrdC affect quinone binding and electron transfer?

Mutations in conserved residues of FrdC can significantly impact quinone binding and electron transfer in the fumarate reductase complex. Research suggests that specific amino acid residues within FrdC form a quinone-binding pocket that is essential for interaction with menaquinol during anaerobic respiration.

Critical conserved residues include:

Residue PositionConservationRole in FunctionEffect of Mutation
Histidine residuesHighly conservedCoordination of quinone bindingReduced quinone reactivity
Arginine residuesConserved in γ-proteobacteriaElectrostatic interactions with quinoneAltered redox potential
Transmembrane helicesStructurally conservedPositioning in membraneDisrupted membrane association

When investigating mutations in FrdC, researchers should consider:

  • Using site-directed mutagenesis to target specific conserved residues

  • Measuring enzymatic activity with different quinone analogues to assess binding specificity

  • Performing complementation assays in frd-deficient strains to evaluate in vivo function

  • Analyzing electron transfer rates using stopped-flow spectroscopy

  • Examining membrane association through subcellular fractionation and Western blotting

These approaches can provide mechanistic insights into how specific residues contribute to quinone binding and the subsequent electron transfer to the catalytic subunits .

What is the relationship between FrdC and FrdD in membrane anchoring and complex assembly?

The relationship between FrdC and FrdD subunits is crucial for proper membrane anchoring and assembly of the functional fumarate reductase complex. Research has established several key aspects of this relationship:

  • Cooperative Function: Both FrdC and FrdD are required for membrane association of fumarate reductase and for the oxidation of reduced quinone analogues. Neither subunit alone is sufficient for proper membrane integration of the catalytic dimer.

  • Structural Association: FrdC and FrdD likely form a heterodimeric membrane anchor that provides the structural foundation for attachment of the catalytic FrdA-FrdB dimer.

  • Assembly Requirement: Experimental evidence demonstrates that separation of the DNA coding for FrdC and FrdD proteins (expressing them from different plasmids) affects the ability of fumarate reductase to assemble into a functional complex. This suggests that co-translation or closely coordinated expression of these subunits may be necessary for proper folding and interaction.

  • Quinone Interaction Site: Together, FrdC and FrdD create the quinone binding site that enables electron transfer from menaquinol to the iron-sulfur clusters in FrdB and ultimately to the FAD cofactor in FrdA.

For researchers investigating this relationship, co-expression studies, pull-down assays, and cross-linking experiments can provide valuable insights into the interaction surfaces and assembly process of these membrane subunits .

How does the structure of FrdC compare between different bacterial species, and what are the functional implications?

The structure of FrdC shows varying degrees of conservation across bacterial species, with important functional implications for fumarate reductase activity and regulation:

Bacterial SpeciesFrdC Size (aa)Transmembrane HelicesKey Structural FeaturesFunctional Specialization
E. coli1313Quinone binding residuesAnaerobic respiration
Wolinella succinogenes2435Extended C-terminusEnhanced stability
Campylobacter jejuni2676Additional binding sitesAlternative electron carriers
Bacillus subtilis2284Different topologyFacultative function

Comparative genomic and structural analyses reveal:

  • The core transmembrane regions are generally conserved, particularly residues involved in quinone binding

  • The number of transmembrane helices varies between species, likely reflecting adaptations to different membrane environments

  • Species that rely more heavily on fumarate respiration often show more complex FrdC structures

  • Some bacteria have evolved specialized FrdC variants for particular ecological niches

These structural differences influence electron transfer efficiency, substrate specificity, and environmental adaptability. Researchers exploring FrdC across species should consider these variations when designing heterologous expression systems or interpreting functional data from different organisms .

What strategies can overcome expression challenges when producing recombinant FrdC in heterologous systems?

Producing recombinant FrdC in heterologous systems presents several challenges due to its membrane-embedded nature and requirement for proper complex assembly. Researchers can implement the following strategies to overcome these obstacles:

  • Promoter Selection:

    • For anaerobic expression, utilize the native P<sub>FRD</sub> promoter of the frdABCD operon

    • For constitutive expression regardless of oxygen status, employ strong constitutive promoters like P<sub>tac</sub> or P<sub>T7</sub>

    • For controlled expression, use inducible systems like arabinose or tetracycline-responsive promoters

  • Co-expression Approaches:

    • Express the entire frdABCD operon rather than frdC alone to ensure proper complex assembly

    • Design constructs with optimized spacing between genes to maintain natural translational coupling

    • Use polycistronic constructs with single promoter control

  • Host Strain Selection:

    • Choose E. coli strains lacking endogenous fumarate reductase (ΔfrdABCD) to avoid interference

    • Consider strains with enhanced membrane protein expression capabilities (e.g., C41(DE3), C43(DE3))

    • For toxic constructs, use strains with tight expression control systems

  • Expression Conditions:

    • Grow cultures at lower temperatures (16-25°C) after induction to slow protein production and improve folding

    • Include membrane-stabilizing agents such as glycerol (5-10%) in growth media

    • For anaerobic expression, ensure complete anaerobic conditions as described in growth protocols

  • Protein Stabilization:

    • Add suitable detergents during membrane protein extraction (e.g., n-dodecyl-β-D-maltoside)

    • Include protease inhibitors to prevent degradation

    • Consider fusion tags that enhance stability while minimizing functional interference

Using a systematic approach that combines these strategies can significantly improve recombinant FrdC expression and functional assembly .

How can researchers distinguish between phenotypes caused by FrdC mutations versus indirect effects on complex assembly?

Distinguishing between direct functional effects of FrdC mutations and indirect effects on complex assembly requires a multi-faceted approach:

  • Protein Expression and Complex Formation Analysis:

    • Perform quantitative Western blot analysis of all four Frd subunits to confirm equivalent expression levels

    • Use blue native PAGE to assess intact complex formation

    • Implement co-immunoprecipitation assays to evaluate subunit interactions

    • Apply size exclusion chromatography to analyze complex integrity

  • Membrane Integration Assessment:

    • Conduct subcellular fractionation to determine proper localization to the membrane

    • Perform protease protection assays to evaluate membrane topology

    • Use fluorescent protein fusions with confocal microscopy to visualize membrane localization

  • Functional Separation Experiments:

    • Isolate membrane fractions and measure fumarate reductase activity

    • Compare benzyl viologen-dependent activity (requires only FrdA-FrdB) with menaquinol-dependent activity (requires intact complex with functional FrdC)

    • Implement reconstitution experiments with purified components

  • In vivo vs. In vitro Comparisons:

    • Assess anaerobic growth phenotypes with fumarate as terminal electron acceptor

    • Measure enzyme activity in membrane preparations

    • Compare results to identify discrepancies that might indicate assembly defects

  • Structure-Function Correlation:

    • Design conservative mutations that maintain structural properties

    • Create systematic alanine-scanning mutations across FrdC

    • Develop a relative activity matrix that correlates mutation position with different functional readouts

By implementing this comprehensive approach, researchers can differentiate between mutations that directly impair FrdC function versus those that primarily disrupt complex assembly .

What controls are essential when studying the interaction between FrdC and electron transport chain components?

  • Strain Background Controls:

    • Use isogenic strains differing only in the frdC genotype

    • Include a complete frdABCD deletion strain as negative control

    • Implement a complemented strain with wild-type frdC as positive control

    • Consider strains with varying levels of quinone biosynthesis

  • Genetic Complementation Controls:

    • Verify that wild-type frdC restores function in an frdC-deficient background

    • Test frdC variants on separate plasmids with identical backbones and promoters

    • Ensure comparable expression levels through qRT-PCR and/or Western blot analysis

  • Biochemical Assay Controls:

    • Include enzyme-free controls to establish baseline activity

    • Measure activity with alternative electron donors/acceptors to isolate specific interactions

    • Verify linearity of assays with respect to protein concentration and time

    • Include positive controls with known activity (e.g., succinate dehydrogenase)

  • Environmental Condition Controls:

    • Maintain strict anaerobic conditions during growth and assays

    • Include aerobically grown samples as comparative controls

    • Test multiple carbon sources to rule out metabolic artifacts

    • Verify pH and temperature consistency across experiments

  • Specificity Controls for Protein-Protein Interactions:

    • Test interaction with non-specific membrane proteins as negative controls

    • Use purified components in reconstitution experiments

    • Perform competition assays with excess untagged protein

    • Implement reverse tagging strategies to confirm interactions

Using this comprehensive set of controls allows researchers to confidently attribute observed effects to specific FrdC-mediated interactions with electron transport chain components rather than experimental artifacts or indirect effects .

How should researchers analyze and interpret conflicting data on FrdC function across different experimental systems?

When faced with conflicting data on FrdC function across different experimental systems, researchers should implement a systematic analytical approach:

  • System Comparison Framework:
    Create a comprehensive comparison table of experimental systems used:

    ParameterSystem ASystem BSystem CPotential Impact
    Host strainE. coli K-12E. coli BL21E. coli O81Expression levels, background metabolism
    Growth conditionsAnaerobic, 37°CMicroaerobic, 30°CAnaerobic, 25°CEnzyme activity, complex stability
    Expression vectorHigh-copyLow-copyChromosomalStoichiometry, assembly
    Assay methodViologen-basedMembrane potentialGrowth complementationSensitivity, physiological relevance
  • Methodological Dissection:

    • Evaluate methodological differences that might explain discrepancies

    • Consider whether in vitro versus in vivo approaches assess different aspects of FrdC function

    • Assess the physiological relevance of each experimental system

    • Examine how substrate concentrations and reaction conditions differ between studies

  • Statistical Meta-Analysis:

    • Normalize data from different studies to common units when possible

    • Implement statistical methods that account for inter-study variability

    • Weight studies based on methodological rigor and sample size

    • Identify consistent trends across multiple experimental systems

  • Molecular Context Consideration:

    • Evaluate whether the complete fumarate reductase complex was present in all systems

    • Assess whether native quinones were available or if artificial electron donors were used

    • Consider differences in membrane composition between systems

    • Examine the influence of other electron transport chain components

  • Hypothesis Reconciliation:

    • Develop integrated models that might explain apparently conflicting results

    • Design critical experiments specifically targeting discrepancies

    • Consider whether FrdC might have context-dependent functions

    • Evaluate if post-translational modifications might differ between systems

By systematically analyzing experimental differences and their potential impacts, researchers can often reconcile seemingly conflicting data and develop more nuanced understanding of FrdC function across different conditions .

What statistical approaches are most appropriate for analyzing structure-function relationships in FrdC mutational studies?

  • Multiple Linear Regression Models:

    • Useful for analyzing how multiple structural parameters (hydrophobicity, charge, size) simultaneously influence functional outcomes

    • Can identify which structural features most strongly predict functional changes

    • Appropriate when studying a large set of mutations with quantitative functional readouts

    • Example: Regression equation calculating activity as a function of multiple physicochemical properties

  • Principal Component Analysis (PCA):

    • Valuable for reducing dimensionality when analyzing multiple structural parameters

    • Helps identify which combinations of structural features explain most variation in function

    • Particularly useful when dealing with highly correlated structural properties

    • Can reveal unexpected patterns in structure-function relationships

  • Hierarchical Clustering:

    • Groups mutations with similar functional profiles

    • Identifies residues that likely share functional roles

    • Helps define functional domains within FrdC

    • Can be visualized through dendrograms showing related functional clusters

  • ANOVA and Post-hoc Tests:

    • Appropriate for comparing functional effects across different classes of mutations

    • Useful when mutations are categorized (e.g., transmembrane vs. loop regions)

    • Tukey's HSD or Bonferroni corrections should be applied for multiple comparisons

    • Can determine statistical significance of functional differences between mutation types

  • Bayesian Network Analysis:

    • Models causal relationships between structural changes and multiple functional parameters

    • Accounts for conditional dependencies between functional readouts

    • Particularly valuable when analyzing mutations affecting complex assembly and function

    • Provides probabilistic framework for predicting functional outcomes of novel mutations

  • Statistical Power Considerations:

    • Calculate minimum sample sizes needed for detecting meaningful effects

    • Account for variability in functional assays

    • Consider biological replicates (different protein preparations) vs. technical replicates

    • Implement power analysis before designing large-scale mutagenesis studies

Proper application of these statistical approaches, with attention to assumptions and limitations, enables robust analysis of structure-function relationships in FrdC .

How can researchers design experiments to elucidate the specific role of FrdC in quinone binding without artifacts from disrupting complex assembly?

Designing experiments that specifically probe FrdC's role in quinone binding while avoiding complex assembly artifacts requires sophisticated approaches:

  • Site-Directed Spin Labeling Combined with EPR Spectroscopy:

    • Introduce cysteine residues at specific sites in FrdC predicted to interact with quinones

    • Label with nitroxide spin labels

    • Perform electron paramagnetic resonance (EPR) spectroscopy to detect changes in local environment upon quinone binding

    • Compare EPR spectra with and without added quinone analogues

    • Advantage: Can detect local structural changes without requiring intact enzyme activity

  • In situ Photocrosslinking with Quinone Analogues:

    • Synthesize photoactivatable quinone analogues containing benzophenone or diazirine groups

    • Allow binding to membrane preparations containing fumarate reductase

    • Perform UV irradiation to crosslink the quinone to its binding pocket

    • Identify crosslinked residues using mass spectrometry

    • Advantage: Directly identifies contact points between FrdC and quinones

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Expose purified fumarate reductase to D₂O-based buffer with and without quinones

    • Analyze patterns of hydrogen-deuterium exchange over time

    • Regions protected from exchange in the presence of quinones likely represent binding interfaces

    • Advantage: Maps binding-induced conformational changes without requiring mutations

  • Genetic Suppressor Analysis:

    • Introduce mutations in FrdC that disrupt quinone binding but preserve complex assembly

    • Screen for second-site suppressor mutations that restore quinone binding

    • Sequence suppressors to identify compensatory changes

    • Map suppressor pairs to build a functional interaction network

    • Advantage: Identifies functionally coupled residues through genetic interactions

  • Computational Docking with Experimental Validation:

    • Develop structural models of FrdC through homology modeling or ab initio prediction

    • Perform in silico docking of various quinone molecules to identify potential binding sites

    • Design mutations predicted to specifically affect quinone binding

    • Validate predictions experimentally using quinone-dependent activity assays

    • Advantage: Provides testable hypotheses about specific residue-quinone interactions

These approaches can isolate quinone binding functions from assembly effects, providing clearer insights into FrdC's specific role in electron transport .

What are the most effective approaches for studying the dynamic interactions between FrdC and other membrane proteins during anaerobic respiration?

Studying dynamic interactions between FrdC and other membrane proteins during anaerobic respiration requires specialized approaches that capture transient associations in the native membrane environment:

  • In vivo Protein-Protein Interaction Methods:

    • FRET (Förster Resonance Energy Transfer):

      • Tag FrdC and potential interaction partners with compatible fluorophores

      • Measure energy transfer efficiency as an indicator of proximity

      • Perform measurements under various respiratory conditions

      • Advantage: Detects interactions in living cells with minimal disruption

    • Split Fluorescent Protein Complementation:

      • Fuse fragments of fluorescent proteins (e.g., GFP, Venus) to FrdC and candidate partners

      • Monitor fluorescence reconstitution as evidence of interaction

      • Implement time-lapse imaging to track dynamic associations

      • Advantage: Strong signal with relatively low background

    • Proximity-Dependent Biotin Labeling (BioID or TurboID):

      • Fuse biotin ligase to FrdC

      • Identify biotinylated proteins using mass spectrometry

      • Map the FrdC "interactome" under different respiratory conditions

      • Advantage: Captures even weak or transient interactions

  • Advanced Microscopy Techniques:

    • Single-Particle Tracking:

      • Label FrdC with quantum dots or photostable fluorophores

      • Track movement in the membrane using super-resolution microscopy

      • Analyze trajectories for evidence of complex formation/dissociation

      • Advantage: Provides dynamic information about individual complexes

    • Stimulated Emission Depletion (STED) Microscopy:

      • Visualize nanoscale organization of respiratory complexes

      • Examine co-localization patterns under different metabolic conditions

      • Advantage: Achieves resolution below diffraction limit for detailed spatial mapping

  • Membrane-Based Biochemical Approaches:

    • Native Electrophoresis of Membrane Complexes:

      • Solubilize membranes under mild conditions preserving protein-protein interactions

      • Separate complexes using blue native PAGE or clear native PAGE

      • Identify components using mass spectrometry or Western blotting

      • Advantage: Preserves large respiratory supercomplexes

    • Quantitative Crosslinking Mass Spectrometry:

      • Treat intact membranes with chemical crosslinkers of defined spacer lengths

      • Digest and analyze crosslinked peptides by mass spectrometry

      • Map interaction interfaces at the residue level

      • Advantage: Provides structural insights into protein complexes

  • Functional Coupling Analysis:

    • Electron Transfer Kinetics:

      • Measure electron transfer rates between quinones and fumarate reductase

      • Compare rates in the presence of various respiratory components

      • Use stopped-flow spectroscopy for rapid measurements

      • Advantage: Directly assesses functional consequences of interactions

    • Respiratory Chain Reconstitution:

      • Create proteoliposomes with defined compositions of respiratory complexes

      • Systematically vary the presence/absence of potential interaction partners

      • Measure respiratory activities and membrane potential generation

      • Advantage: Controls exact composition of the system

These approaches provide complementary information about the dynamic associations between FrdC and other components of the anaerobic respiratory chain .

What are the most common pitfalls in purifying and characterizing recombinant FrdC, and how can they be addressed?

Purifying and characterizing recombinant FrdC presents several challenges due to its hydrophobic nature and requirement for proper assembly. Below are common pitfalls and their solutions:

  • Low Expression Yields:

    • Pitfall: Toxicity due to membrane protein overexpression

    • Solution: Use tightly regulated expression systems with moderate induction; consider specialized strains like C41(DE3) designed for membrane protein expression; lower growth temperature to 16-20°C after induction; use enriched media with added glucose to reduce leaky expression

  • Protein Aggregation:

    • Pitfall: Formation of inclusion bodies due to improper membrane insertion

    • Solution: Co-express with the complete frdABCD operon; include molecular chaperones (GroEL/GroES); optimize expression temperature and inducer concentration; consider fusion partners that enhance solubility

  • Loss of Association with Other Subunits:

    • Pitfall: Dissociation of FrdC from FrdA, FrdB, and FrdD during purification

    • Solution: Use mild detergents (DDM, LMNG); avoid harsh extraction conditions; implement tandem affinity purification with tags on different subunits; crosslink subunits prior to extraction if studying structural properties

  • Detergent Selection Issues:

    • Pitfall: Inappropriate detergent causing denaturation or micelle problems

    • Solution: Screen multiple detergents in parallel; consider detergent stability, CMC values, and micelle size; implement detergent exchange during purification; use nanodiscs or amphipols for long-term stability

  • Loss of Quinone Binding Activity:

    • Pitfall: Removal of endogenous quinones during purification

    • Solution: Supplement buffers with ubiquinone-1 or menaquinone analogues; measure quinone content by HPLC; reconstitute with defined quinone species before activity assays

  • Poor Reconstitution into Proteoliposomes:

    • Pitfall: Incorrect orientation or inefficient incorporation

    • Solution: Optimize lipid composition to mimic E. coli membrane; control protein:lipid ratios; use slow detergent removal methods (dialysis or biobeads); verify orientation by protease protection assays

  • Activity Measurement Challenges:

    • Pitfall: Background reactions or non-specific electron transfer

    • Solution: Include proper controls (heat-inactivated enzyme, inhibitors); optimize assay conditions (pH, temperature, ionic strength); use specific substrates rather than artificial electron donors/acceptors when possible

  • Structural Characterization Difficulties:

    • Pitfall: Conformational heterogeneity or instability

    • Solution: Use GraFix method (gradient fixation); implement thermostability assays to identify stabilizing conditions; consider cryo-EM rather than crystallography for structural studies; use hydrogen-deuterium exchange mass spectrometry for conformational analysis

By anticipating these challenges and implementing appropriate solutions, researchers can significantly improve their success in purifying and characterizing recombinant FrdC .

How can researchers distinguish between the specific roles of FrdC and FrdD when both are necessary for complex function?

Distinguishing between the specific roles of FrdC and FrdD presents a significant challenge since both are required for complex function. Researchers can implement the following strategies to delineate their individual contributions:

  • Chimeric Protein Analysis:

    • Create chimeric proteins by swapping domains between FrdC and FrdD

    • Evaluate which domains are responsible for specific functions

    • Analyze whether certain domains are interchangeable between the subunits

    • Map specific functions to discrete regions of each protein

  • Cysteine Scanning Mutagenesis:

    • Systematically replace individual residues with cysteine in both FrdC and FrdD

    • Label with thiol-reactive probes to assess accessibility

    • Evaluate effects on quinone binding, membrane insertion, and complex assembly

    • Identify residues in each subunit that contribute to specific functions

  • Asymmetric Tagging Strategy:

    • Introduce affinity or fluorescent tags specifically on either FrdC or FrdD

    • Perform pull-down experiments to identify specific interaction partners

    • Use FRET analysis to measure proximity to other respiratory components

    • Determine if the subunits interact with different proteins in the membrane

  • Selective Inhibition Approach:

    • Design antibodies or nanobodies that selectively bind to exposed epitopes on either FrdC or FrdD

    • Evaluate functional consequences of binding to each subunit independently

    • Identify function-specific inhibitory effects

  • Evolutionary Analysis:

    • Compare sequences of FrdC and FrdD across diverse bacterial species

    • Identify conserved motifs specific to each subunit

    • Correlate conservation patterns with known functional requirements

    • Infer specialized roles based on evolutionary constraints

  • Suppressor Analysis with Subunit Specificity:

    • Introduce defects in either FrdC or FrdD and screen for suppressors

    • Identify whether suppressors occur in the same or different subunit

    • Map functional pathways based on suppressor relationships

    • Determine whether certain functions are more associated with one subunit

  • Selective Proteolysis:

    • Engineer specific protease sites into accessible regions of either FrdC or FrdD

    • Induce selective degradation of one subunit

    • Monitor partial activities or intermediate assembly states

    • Identify which functions are lost first upon disruption of each subunit

  • Computational Analysis of Energy Coupling:

    • Perform molecular dynamics simulations of the complete complex

    • Analyze energy transfer pathways through each subunit

    • Identify residues involved in allosteric communication

    • Predict functional specialization based on structural dynamics

Through these complementary approaches, researchers can build a detailed map of the specialized roles of FrdC and FrdD while acknowledging their interdependent functions within the fumarate reductase complex .

What emerging technologies offer the most promise for understanding FrdC's role in the context of complete anaerobic respiratory chains?

Emerging technologies are revolutionizing our ability to understand membrane proteins like FrdC in their native contexts. The most promising approaches for elucidating FrdC's role in complete anaerobic respiratory chains include:

These emerging technologies, particularly when used in combination, promise to transform our understanding of FrdC's role within the complex and dynamic anaerobic respiratory chains of E. coli .

What are the most significant unresolved questions regarding FrdC structure and function that future research should address?

Despite decades of research on bacterial respiratory chains, several critical questions about FrdC structure and function remain unresolved. Future research should prioritize addressing these knowledge gaps:

  • Quinone Binding Mechanism:

    • What is the precise binding site for menaquinone in FrdC?

    • How does quinone binding trigger conformational changes that facilitate electron transfer?

    • What determines the specificity for different quinone types (menaquinone vs. ubiquinone)?

    • Which residues are directly involved in proton-coupled electron transfer reactions?

  • Membrane Dynamics and Organization:

    • Does FrdC participate in respiratory supercomplexes under physiological conditions?

    • How does FrdC contribute to the organization of the membrane during adaptation to anaerobic conditions?

    • What is the lateral mobility of fumarate reductase in the membrane during active respiration?

    • How does membrane composition affect FrdC function and stability?

  • Regulatory Mechanisms:

    • Are there post-translational modifications that regulate FrdC function?

    • How does FrdC respond to changes in membrane potential or pH?

    • Are there allosteric interactions between the catalytic and membrane domains mediated by FrdC?

    • What signals trigger assembly or disassembly of the fumarate reductase complex?

  • Evolutionary Relationships:

    • How did the specialized roles of FrdC and FrdD evolve from potential gene duplication events?

    • Why do some bacterial species maintain separate enzymes for fumarate reduction and succinate oxidation while others use bidirectional enzymes?

    • What structural adaptations in FrdC enable function in different bacterial species with varying membrane compositions?

    • Can evolutionary patterns in FrdC be used to predict quinone preference?

  • Structural Dynamics:

    • What conformational changes occur in FrdC during the catalytic cycle?

    • How does electron transfer through FrdC affect its interaction with FrdA/B?

    • What is the structural basis for the proton translocation mechanism associated with quinone reduction?

    • How stable is the FrdC-FrdD interaction during enzyme turnover?

  • Alternative Functions:

    • Does FrdC have additional roles beyond anaerobic respiration?

    • Can FrdC interact with alternative electron acceptors under certain conditions?

    • Does fumarate reductase play a role in maintaining redox balance during transitions between aerobic and anaerobic growth?

    • Are there conditions under which FrdC contributes to other metabolic pathways?

  • Pathogenic Relevance:

    • How does FrdC function contribute to bacterial pathogenesis during anaerobic infection?

    • Could FrdC serve as a target for antimicrobial development?

    • Do mutations in FrdC affect bacterial virulence or antibiotic susceptibility?

    • How does host environment influence FrdC expression and function during infection?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, computational modeling, and systems biology. The answers will not only enhance our fundamental understanding of bacterial energy metabolism but may also reveal new targets for antimicrobial development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.