Recombinant Escherichia coli O81 Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdD; ECED1_4940; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized in anaerobic growth, while succinate dehydrogenase functions in aerobic growth. The FrdD subunit anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of fumarate reductase subunit D (frdD) in E. coli?

Fumarate reductase in E. coli functions as a membrane-bound enzyme that catalyzes the reduction of fumarate to succinate during anaerobic respiration. The enzyme consists of four subunits (frdA, frdB, frdC, and frdD) encoded by the frdABCD gene cluster. Specifically, frdD (GenBank No: ACA79463.1) encodes the fumarate reductase D subunit, which along with frdC forms the membrane anchor portion of the complex. This membrane anchor is essential for proper localization and stability of the catalytic subunits.

The frdD subunit is predominantly involved in:

  • Anchoring the enzyme complex to the cytoplasmic membrane

  • Facilitating electron transfer between respiratory components

  • Maintaining the structural integrity of the enzyme complex

Research by Zhou et al. has demonstrated that deletion or modification of the frdABCD gene cluster affects the anaerobic respiration pathway, as seen in strains engineered for D-lactate production .

How does the structure of frdD contribute to the function of the fumarate reductase complex?

The frdD subunit is a small hydrophobic protein that works in conjunction with frdC to anchor the catalytic subunits (frdA and frdB) to the membrane. Structurally, frdD contains transmembrane domains that integrate into the cytoplasmic membrane. These structural features are critical for:

  • Proper orientation of the catalytic domains toward the cytoplasm

  • Stability of the entire enzyme complex

  • Facilitation of electron transfer chain interactions

Studies on the quaternary structure reveal that frdD interacts extensively with frdC, forming a stable membrane anchor dimer that provides the foundation for attachment of the catalytic dimer (frdA-frdB). This structural arrangement ensures that electrons can flow efficiently from the membrane quinone pool to the active site where fumarate reduction occurs.

What are the optimal strains and conditions for expressing recombinant frdD in E. coli?

The expression of recombinant frdD is most effective when considering both the expression strain and culture conditions. Based on current research:

Recommended Expression Strains:

  • BL21(DE3) and derivatives: Most commonly used (65% of reference cases) due to deficiency in Lon and OmpT proteases, providing protection to potentially misfolded membrane proteins

  • Rosetta strains: Beneficial when frdD sequences contain rare codons

  • C41(DE3) or C43(DE3): Often preferred for membrane proteins like frdD

Optimal Culture Conditions:

  • Temperature: 25-30°C post-induction to slow protein synthesis and improve folding

  • Media: Enriched media for initial growth, followed by mineral salt media during induction

  • Oxygen: Micro-aerobic or anaerobic conditions to mimic native expression environment

  • Inducer: Low concentrations of IPTG (0.1-0.5 mM) for controlled expression

The choice between K12 and B strains is significant, as shown in the following data from recombinant enzyme expression studies:

Strain CategoryUsage PercentageCommon ApplicationsKey Advantages
B strains (BL21 and derivatives)88%High-yield protein expressionDeficient in proteases, rapid growth, high biomass
K12 derivatives12%Plasmid stability, cloningBetter for plasmid maintenance when instability is encountered

For membrane proteins like frdD, specialized strains such as ArcticExpress or Rosetta-gami may offer additional benefits by enhancing proper folding .

Which expression vectors are most suitable for recombinant frdD production?

When selecting expression vectors for recombinant frdD, consider the following factors:

  • Promoter strength: The T7 expression system offers rapid protein synthesis and high titers but may lead to inclusion body formation for membrane proteins like frdD. Consider using tunable promoters like the araBAD promoter for more controlled expression.

  • Fusion tags: N-terminal fusion tags can enhance solubility and facilitate purification:

    • MBP (maltose-binding protein) - increases solubility

    • SUMO - improves folding and can be cleanly removed

    • His6 - enables purification but has minimal impact on solubility

  • Vector copy number: Low to medium copy vectors (such as pET derivatives with pBR322 origin) often provide better expression of membrane proteins than high copy vectors.

  • Selection marker: Antibiotic resistance genes should be compatible with the host strain.

Based on recent studies, the following vector systems have shown success for membrane protein expression:

  • pET-based vectors with T7lac promoter and optional lacI repressor

  • pBAD vectors with the arabinose-inducible promoter

  • pASK vectors with tet promoter systems

For co-expression of multiple subunits of the frd complex, compatible vectors like pCDF, pACYC, or pRSF can be used in conjunction with the primary expression vector.

What strategies can be employed to overcome inclusion body formation when expressing recombinant frdD?

Inclusion body formation is a common challenge when expressing membrane proteins like frdD. Based on the systematic review of literature from 2010 to 2021 , the following strategies can be implemented:

  • Temperature optimization:

    • Lower post-induction temperature to 16-25°C

    • Use ArcticExpress (DE3) strain that expresses chaperones active at low temperatures

  • Expression rate control:

    • Use Tuner(DE3) strains that allow adjustable inducer concentrations

    • Implement auto-induction methods for gradual protein expression

  • Co-expression strategies:

    • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

    • Co-express other frd subunits to promote complex formation

  • Fusion protein approaches:

    • N-terminal solubility enhancers (MBP, SUMO, TrxA)

    • C-terminal stabilizing domains

  • Media and feeding strategies:

    • Implement fed-batch cultivation with controlled nutrient delivery

    • Use high-cell-density cultures with OD600 of 10-20 for improved yields

The combination of these approaches should be tailored to the specific expression challenges of frdD. For example, the APEX automated protein expression system can be utilized to systematically test multiple conditions in parallel, accelerating optimization .

How can omics-based approaches improve experimental design for recombinant frdD expression?

Omics-based investigations can provide valuable insights for optimizing recombinant frdD expression. The systems-level analysis can reveal:

  • Transcriptomics insights:

    • Global transcriptional changes in response to inclusion body formation

    • Upregulation of molecular chaperones, aminoacyl-tRNA synthetases, and energy metabolism genes during stress responses

    • Specific E. coli responses to membrane protein overexpression

  • Proteomics applications:

    • Monitoring of co-expressed chaperone levels

    • Detection of protein degradation products

    • Evaluation of membrane protein integration efficiency

  • Metabolomics optimization:

    • Analysis of metabolic networks reorganization during expression

    • Identification of metabolic bottlenecks affecting protein production

Research by Sharma et al. demonstrated that transcription of amino acid biosynthesis and uptake genes was upregulated during inclusion body formation, whereas these genes were downregulated during soluble expression . This indicates that the physical state of the recombinant protein has a global impact on metabolism, which should inform feeding strategies and media composition.

Implementation of an integrated omics approach allows for rational strain engineering to address specific bottlenecks in frdD expression, rather than relying on trial-and-error optimization.

How can recombineering techniques be applied to modify the chromosomal frdD gene in E. coli?

Recombineering (recombination-based genetic engineering) offers powerful techniques for precise modification of the chromosomal frdD gene without reliance on restriction sites. Based on the protocol developed by Court's laboratory , the following methodological approach can be implemented:

  • Preparation of recombination-competent cells:

    • Transform E. coli with a plasmid expressing the λ Red recombination system (e.g., pKD46)

    • Grow cells at 30°C with arabinose induction to express Red functions

  • Design of linear DNA substrates:

    • For gene knockout: Design PCR primers with 50 bp homology arms flanking frdD and a selectable marker (e.g., kanamycin resistance)

    • For point mutations: Design 70-100 nt synthetic oligonucleotides with the desired mutation centered within the sequence

  • Transformation and selection:

    • Electroporate linear DNA into recombination-competent cells

    • Select transformants on appropriate antibiotic media

    • Verify recombinants by PCR, sequencing, or restriction analysis

  • Marker removal (if needed):

    • Use counter-selectable markers (e.g., sacB) for scarless modifications

    • Implement two-step selection/counter-selection protocols

An example workflow for frdD deletion would involve:

  • Designing primers with 50 bp homology to regions flanking frdD, plus sequences to amplify a selectable marker

  • PCR amplification of the selection cassette with these primers

  • Electroporation into Red-expressing E. coli cells

  • Selection and verification of recombinants

This approach has been successfully used to modify the frdABCD gene cluster in the construction of strains like Dlac-004, which showed improved D-lactate production .

What methods can be used to study the interactions between frdD and other subunits of the fumarate reductase complex?

Understanding the interactions between frdD and other subunits requires specialized techniques for membrane protein complexes:

  • Co-purification approaches:

    • Tandem affinity purification with tags on different subunits

    • Size exclusion chromatography to isolate intact complexes

    • Blue native PAGE for analysis of membrane protein complexes

  • Structural biology methods:

    • Cryo-electron microscopy for intact complex visualization

    • X-ray crystallography of reconstituted complexes

    • NMR spectroscopy for dynamic interaction studies

  • Crosslinking mass spectrometry:

    • Chemical crosslinking of interacting regions

    • MS/MS analysis to identify crosslinked peptides

    • Computational modeling of interaction interfaces

  • Bacterial two-hybrid systems:

    • Twin-arginine transporter pathway-based two-hybrid systems

    • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system

    • Split-protein complementation assays

  • Functional complementation studies:

    • Expression of subunit combinations in deletion strains

    • Activity assays to assess functional reconstitution

    • Site-directed mutagenesis to map interaction domains

These techniques can reveal how frdD contributes to the assembly and stability of the fumarate reductase complex, providing insights for engineering improved versions with enhanced activity or stability.

How can transcriptional and metabolic responses to oxygen tension be leveraged to optimize recombinant frdD expression?

Fumarate reductase expression is naturally regulated by oxygen tension, as it functions primarily during anaerobic respiration. Research on transcriptional and metabolic responses to dissolved oxygen tension (DOT) provides insights for optimization :

  • Oxygen regulation strategies:

    • Implement oscillatory DOT conditions to mimic large-scale bioreactor gradients

    • Create two-compartment systems with anaerobic (0% DOT) and microaerobic (10% DOT) zones

    • Use controlled oxygen limitation rather than strict anaerobiosis

  • Transcriptional responses to monitor:

    • Mixed acid fermentation genes (increased 1.5 to 6-fold under oscillatory DOT)

    • Cytochrome bd expression (higher affinity for oxygen but lower energy efficiency)

    • Global regulators of aerobic/anaerobic metabolism (fnr, arcA, and arcB)

  • Practical implementation:

    • Design fed-batch processes with controlled oxygen limitation phases

    • Monitor acetate formation as an indicator of overflow metabolism

    • Adjust feeding strategies based on oxygen availability

The study by Caldwell et al. provides a systematic fed-batch cultivation method that can be adapted for frdD expression, allowing for controlled oxygen limitation while maintaining high cell densities.

Key findings from DOT oscillation studies that can inform frdD expression:

Gene CategoryExpression Under Oscillatory DOTImplication for frdD Expression
Mixed acid fermentation genes (including frdD)1.5 to 6-fold increaseEnhanced expression window during oxygen limitation
TCA cycle genes (sucA, sucB)DecreasedReduced carbon flux through aerobic pathways
Cytochrome expressionShift to cytochrome bdAdaptation to microaerobic conditions
Global regulators (fnr, arcA)Altered expressionPotential targets for co-expression or strain engineering

What are the key considerations for scaling up recombinant frdD production from laboratory to pilot scale?

Scaling up recombinant frdD production requires addressing several critical factors to maintain productivity while increasing volume:

  • Media and feeding strategy optimization:

    • Implement defined media with controlled carbon-to-nitrogen ratios

    • Design exponential feeding strategies based on growth kinetics

    • Consider high-cell-density fed-batch cultures to achieve >50g dry cell weight per liter

  • Oxygen transfer considerations:

    • Calculate oxygen transfer requirements based on culture density

    • Design appropriate agitation and aeration systems

    • Implement cascade control of dissolved oxygen for consistent microaerobic conditions

  • Induction parameters:

    • Determine optimal cell density for induction (typically mid-exponential phase)

    • Adjust inducer concentration to prevent metabolic burden

    • Consider temperature downshift at induction to enhance proper folding

  • Process monitoring and control:

    • Implement real-time monitoring of critical parameters (pH, DOT, glucose)

    • Develop feed-back control systems based on metabolic indicators

    • Use scale-down models to predict and address heterogeneities in larger vessels

  • Harvesting and downstream processing:

    • Optimize cell harvesting to preserve membrane integrity

    • Develop efficient membrane protein extraction protocols

    • Scale membrane solubilization and purification steps accordingly

The method described by Caldwell et al. provides a robust foundation for scaling up, as it utilizes a predefined exponential feeding strategy and conservative induction protocol that can be adapted to larger volumes without extensive trial-and-error studies.

How can CRISPR-Cas systems enhance genetic manipulation of the frdABCD gene cluster?

CRISPR-Cas technology offers significant advantages over traditional recombineering for manipulating the frdABCD gene cluster:

  • Multiplex editing capabilities:

    • Simultaneously modify multiple sites within the frdABCD operon

    • Create combinatorial libraries of mutations across subunits

    • Implement precise deletions, insertions, or base editing

  • Methodological approach:

    • Design sgRNAs targeting specific regions within frdD or other subunits

    • Co-express Cas9 and sgRNA from a single plasmid

    • Provide repair templates with desired modifications

    • Select transformants and verify edits by sequencing

  • Advanced applications:

    • CRISPRi for tunable repression of native frdABCD expression

    • CRISPRa for enhanced expression of recombinant variants

    • Base editors for precise single nucleotide modifications without double-strand breaks

  • Integration with high-throughput screening:

    • Create variant libraries of frdD for structure-function analysis

    • Combine with growth-based selection in anaerobic conditions

    • Implement automated screening platforms like APEX for rapid phenotyping

This technology allows researchers to rapidly generate and test hypotheses about structure-function relationships in frdD without the limitations of traditional cloning or recombineering approaches.

What are the emerging systems biology approaches for optimizing recombinant membrane protein expression?

Systems biology approaches are increasingly valuable for addressing the challenges of membrane protein expression:

  • Genome-scale metabolic modeling:

    • Predict metabolic flux distributions during recombinant expression

    • Identify potential bottlenecks in cofactor regeneration or amino acid biosynthesis

    • Guide media formulation and feeding strategies

  • Integrative multi-omics:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Develop machine learning models to predict optimal expression conditions

    • Identify global cellular responses to membrane protein overproduction

  • Synthetic biology strategies:

    • Design orthogonal expression systems with minimal cross-talk to host metabolism

    • Implement dynamic sensor-regulator systems that respond to cellular stress

    • Develop synthetic genetic circuits for auto-regulated expression

  • Host cell engineering:

    • Rational design of chassis strains with reduced proteolytic activity

    • Augmentation of membrane capacity through phospholipid biosynthesis engineering

    • Enhancement of chaperone networks specific to membrane protein folding

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.