Recombinant Escherichia coli O81 Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
plsY; ygiH; ECED1_3728; Glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
plsY
Target Protein Sequence
MSAIAPGMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGATNVLRIGGKGAAVAVLI FDVLKGMLPVWGAYELGVSPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN IQRLWRRQETKIWTKFKRKREKDPE
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-ACP to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). This enzyme can also utilize acyl-CoA as a fatty acyl donor, but not acyl-PO(4).
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its significance in bacterial metabolism?

Glycerol-3-phosphate acyltransferase (plsY) is a membrane-integral enzyme that catalyzes the committed and essential step in bacterial phospholipid biosynthesis. It functions by acylating glycerol 3-phosphate (G3P) to form lysophosphatidic acid (lysoPA), which subsequently undergoes a second acylation to form phosphatidic acid (PA), a central intermediate in phospholipid metabolism . PlsY represents a unique class of acyltransferase that is exclusive and ubiquitous in bacteria, with no eukaryotic homologs . It serves as the sole and therefore essential glycerol-3-phosphate acyltransferase (GPAT) in most Gram-positive bacteria, making it critical for bacterial membrane formation and integrity .

The significance of plsY lies in its fundamental role in the most widely distributed biosynthetic pathway that initiates phosphatidic acid formation in bacterial membrane phospholipid biosynthesis. This process involves the conversion of acyl-acyl carrier protein to acylphosphate by PlsX and the subsequent transfer of the acyl group from acylphosphate to glycerol 3-phosphate by PlsY . This reaction constitutes the first step in the synthesis of lipids in bacteria like E. coli .

How does the structure of plsY differ from other acyltransferases?

PlsY possesses several structural characteristics that distinguish it from other acyltransferases:

  • Unique membrane topology: PlsY has a distinct seven-transmembrane helix fold as revealed by crystal structure determination at 1.48 Å resolution . Studies using the substituted cysteine accessibility method have demonstrated that the protein has five membrane-spanning segments with the amino terminus and two short loops located on the external face of the membrane .

  • Absence of known acyltransferase motifs: Unlike other enzymes in this class, plsY contains no previously identified acyltransferase motifs, making it structurally distinct .

  • Distinct active site architecture: PlsY has a relatively inflexible active site as determined through substrate- and product-bound structures . Each of its three larger cytoplasmic domains contains a highly conserved sequence motif critical for catalysis .

  • Unique substrate preference: Unlike other acyltransferases that use acyl-CoA or acyl-carrier protein as acyl donors, plsY uniquely utilizes acyl-phosphate (acylP) for its acylation reaction .

This distinct structural arrangement supports plsY's specialized function in bacterial phospholipid biosynthesis and explains why it has no functional homologs in eukaryotes.

What are the conserved motifs in plsY and their functional significance?

PlsY contains three highly conserved sequence motifs, each located in the protein's cytoplasmic domains and each playing a critical role in catalytic function :

Motif 1: Contains essential serine and arginine residues that are crucial for enzyme activity. These residues likely participate directly in the catalytic mechanism, potentially contributing to substrate binding or transition state stabilization .

Motif 2: Exhibits characteristics of a phosphate-binding loop and constitutes the glycerol 3-phosphate binding site. When the conserved glycines in this motif are mutated to alanines, a significant defect in the Km for glycerol 3-phosphate binding occurs, confirming this motif's role in substrate recognition and binding .

Motif 3: Contains a conserved histidine and asparagine that are important for catalytic activity, as well as a glutamate residue that is critical for maintaining the structural integrity of PlsY .

Together, these motifs create the specialized catalytic machinery that enables plsY to perform its unique acyltransferase function, distinguishing it from other enzymes in this class and supporting its essential role in bacterial phospholipid synthesis.

What expression systems are optimal for producing recombinant plsY protein for structural and functional studies?

For effective production of recombinant plsY protein, researchers have successfully employed several expression systems, each with distinct advantages depending on the experimental objectives:

Baculovirus Expression System:
This eukaryotic expression system has proven effective for producing recombinant E. coli O81 plsY, achieving protein purity exceeding 85% as determined by SDS-PAGE . The baculovirus system is particularly valuable when working with membrane proteins like plsY because it provides a eukaryotic processing environment that can facilitate proper folding while still producing bacterial proteins.

E. coli Expression System:
For full-length E. coli plsY (1-205 amino acids), expression in E. coli with an N-terminal His-tag has been successfully implemented . This homologous expression approach has the advantage of producing the protein in its native bacterial environment, potentially preserving specific structural characteristics. This system is particularly suited for:

  • High-yield protein production

  • Isotopic labeling for NMR studies

  • Site-directed mutagenesis experiments

A comparison of expression yields from different systems:

Expression SystemTypical Yield (mg/L culture)Purity (SDS-PAGE)Advantages
Baculovirus1-5>85%Better membrane protein folding, post-translational modifications
E. coli5-20>90%Higher yield, isotopic labeling capability, cost-effective

For structural studies, the crystal structure of plsY at 1.48 Å resolution was determined using protein expressed in a system that allowed for proper membrane insertion and folding, which was critical for capturing the seven-transmembrane helix fold of the protein . When designing expression constructs, researchers should consider:

  • Including appropriate affinity tags (typically His-tag) for purification

  • Optimizing codon usage for the expression host

  • Incorporating protease cleavage sites if tag removal is desired

  • Using specialized E. coli strains designed for membrane protein expression

The choice of detergent during extraction and purification is particularly critical for maintaining plsY in a functional state for both structural and biochemical studies .

What are the most effective methods for assessing plsY enzymatic activity in vitro?

Several robust methods have been developed to assess plsY enzymatic activity in vitro, each with specific advantages for different research questions:

High-Throughput Enzymatic Assay:
A high-throughput enzymatic assay for plsY has been developed that enables rapid screening of enzyme activity and potential inhibitors . This method is particularly valuable for:

  • Inhibitor screening campaigns

  • Mutant enzyme characterization

  • Structure-activity relationship studies

Kinetic Analysis with Acyl-Phosphate and G3P:
The standard approach for measuring plsY activity involves monitoring the transfer of the acyl group from acylphosphate to glycerol 3-phosphate. Key parameters typically measured include:

ParameterTypical Value for Wild-Type E. coli PlsYMeasurement Method
Km for acylP5-20 μMVarying acylP concentration with fixed G3P
Km for G3P20-100 μMVarying G3P concentration with fixed acylP
kcat10-50 s⁻¹Initial velocity at saturating substrate concentrations
Inhibition by palmitoyl-CoANoncompetitive inhibitionActivity with varying inhibitor concentrations

Site-Directed Mutagenesis Coupled with Activity Assays:
This approach has been particularly valuable for elucidating the roles of specific residues in catalysis. For example, mutations of conserved glycines in motif 2 to alanines resulted in a Km defect for glycerol 3-phosphate binding, confirming this motif's role as the G3P binding site .

Substituted Cysteine Accessibility Method (SCAM):
This technique has been successfully employed to determine the membrane topology of Streptococcus pneumoniae PlsY . By systematically introducing cysteine residues and assessing their accessibility to membrane-impermeable sulfhydryl reagents, researchers established that plsY has five membrane-spanning segments with specific topology relative to the membrane.

For accurate activity assessment, attention must be paid to:

  • Preparation of pure, active acyl-phosphate substrate (which is unstable)

  • Appropriate detergent selection to maintain enzyme solubility without compromising activity

  • Buffer conditions that mimic the native membrane environment

  • Controls for potential phosphatase activity that could deplete acyl-phosphate substrate

These methodologies collectively provide a comprehensive toolkit for characterizing plsY enzymatic function in vitro.

How can researchers effectively reconstitute plsY into artificial membrane systems for functional studies?

Reconstitution of plsY into artificial membrane systems is critical for studying its function in an environment that mimics its native lipid bilayer context. Effective reconstitution protocols typically follow these methodological steps:

Protein Preparation:

  • Begin with highly purified plsY protein (>90% purity by SDS-PAGE)

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50%, with 50% being optimal for many applications

Liposome Preparation and Reconstitution:

  • Prepare liposomes using E. coli lipid extracts or defined phospholipid mixtures (typically POPE:POPG at 3:1 ratio)

  • Solubilize liposomes with detergent (common choices include DDM, DM, or Triton X-100)

  • Add purified plsY protein at a lipid-to-protein ratio of 50:1 to 200:1

  • Remove detergent gradually using Bio-Beads or dialysis

3. Functional Validation:
After reconstitution, validate functional incorporation by:

  • Measuring acyltransferase activity using acyl-phosphate and G3P substrates

  • Assessing membrane orientation using protease protection assays

  • Confirming protein incorporation by freeze-fracture electron microscopy

Artificial Membrane Systems for PlsY Studies:

System TypeCompositionApplicationsSpecial Considerations
ProteoliposomesE. coli lipids or POPE:POPG (3:1)Activity assays, substrate transportEnsure unilamellar vesicles
NanodiscsMSP1D1, POPC, PlsYStructural studies, single-molecule experimentsControl protein:disc stoichiometry
Lipid Cubic PhaseMonoolein, cholesterolCrystallization trialsCompatible with membrane protein crystallization
Supported Lipid BilayersDOPC, DPPCSurface-sensitive biophysical techniquesEnsure uniform bilayer formation

Important Methodological Considerations:

  • The choice of detergent is critical and should be optimized for each specific plsY construct

  • Temperature control during reconstitution affects incorporation efficiency

  • The lipid composition significantly impacts protein activity and stability

  • For crystallization studies, specific lipid additives may be necessary to maintain protein stability

When working with the reconstituted enzyme, remember that repeated freeze-thaw cycles should be avoided to maintain activity . For short-term experiments, reconstituted plsY can be stored at 4°C for up to one week with minimal loss of activity .

How does the catalytic mechanism of plsY differ from other acyltransferases and what experimental evidence supports this difference?

The catalytic mechanism of plsY represents a significant departure from conventional acyltransferases, employing what has been termed "substrate-assisted catalysis" rather than relying on a proteinaceous catalytic base . This unique mechanism is supported by several lines of experimental evidence:

Structural Evidence:
Crystal structures of plsY at 1.48 Å resolution, including substrate- and product-bound forms, reveal an active site architecture that differs fundamentally from other acyltransferases . The active site appears relatively inflexible, suggesting a catalytic mechanism that relies more on precise substrate positioning than on protein conformational changes .

Substrate Specificity:
Unlike most acyltransferases that utilize acyl-CoA or acyl-carrier protein as acyl donors, plsY specifically uses acyl-phosphate . This unusual acyl donor contains a high-energy phosphate bond that likely contributes directly to the catalytic mechanism, providing the necessary energy for the acyl transfer reaction without requiring additional activation by the enzyme .

Mutagenesis Studies:
Site-directed mutagenesis experiments have identified several critical residues in the three conserved motifs of plsY that are essential for catalysis :

MotifKey ResiduesEffect of MutationMechanistic Implication
Motif 1Serine, ArginineLoss of catalytic activityEssential for substrate binding/catalysis
Motif 2Conserved GlycinesIncreased Km for G3PForms G3P binding site
Motif 3Histidine, AsparagineReduced activityImportant for catalysis
Motif 3GlutamateStructural destabilizationMaintains structural integrity

The absence of a canonical catalytic triad or dyad, typically found in other acyltransferases, suggests that plsY employs a different catalytic strategy .

Proposed Mechanism:
Based on the structural and biochemical data, the "substrate-assisted catalysis" mechanism likely involves:

  • Binding of acyl-phosphate to the enzyme active site

  • Positioning of glycerol 3-phosphate in proximity to the acyl-phosphate

  • Direct nucleophilic attack by the hydroxyl group of G3P on the carbonyl carbon of acyl-phosphate

  • The phosphate group of acyl-phosphate acting as the leaving group and potentially as a catalytic base to activate the G3P hydroxyl

  • Formation of lysophosphatidic acid without requiring a protein-supplied catalytic base

This mechanistic model explains plsY's unique substrate requirements and evolutionary divergence from other acyltransferase families. The mechanism has significant implications for inhibitor design, suggesting that effective inhibitors might target the substrate binding sites rather than attempting to mimic a transition state that depends on a proteinaceous catalytic base .

What structural features contribute to the substrate specificity of plsY, and how can this inform inhibitor design?

The substrate specificity of plsY is defined by several distinct structural features that have been elucidated through crystallographic, biochemical, and mutagenesis studies. These features provide critical insights for rational inhibitor design:

1. Acyl-Phosphate Binding Pocket:
The crystal structure of plsY at 1.48 Å resolution reveals a specialized binding pocket for acyl-phosphate that accommodates this unique substrate . Unlike other acyltransferases that bind acyl-CoA or acyl-carrier protein, the plsY binding site is specifically shaped to recognize the acyl-phosphate moiety, with distinct regions for the acyl chain and the phosphate group .

2. Glycerol 3-Phosphate Binding Site:
Motif 2 in plsY has been identified as the glycerol 3-phosphate binding site through mutagenesis studies . This region shows characteristics of a phosphate-binding loop, with conserved glycine residues that are critical for substrate binding . Mutations of these glycines to alanines result in a significant increase in the Km for G3P, confirming their role in substrate recognition .

3. Transmembrane Architecture:
The seven-transmembrane helix fold of plsY creates a unique three-dimensional arrangement that positions the catalytic residues and substrate binding sites optimally within the membrane environment . This architecture likely contributes to substrate specificity by creating a hydrophobic environment for the acyl chain while maintaining accessibility to the water-soluble phosphate groups.

Implications for Inhibitor Design:

Based on these structural features, several strategies for inhibitor design emerge:

Target RegionInhibitor StrategyDesign ConsiderationsPotential Advantage
Acyl-phosphate binding siteAcyl-phosphate analogs with non-hydrolyzable bondsMaintain phosphate group recognition, modify acyl chainHigh specificity for plsY
G3P binding siteG3P mimetics with modified hydroxyl groupsPreserve phosphate interaction, block nucleophilic attackPrevent substrate binding
Interface between binding sitesMolecules spanning both sitesDesign bifunctional moleculesHigher affinity through multiple binding sites
Transmembrane regionMembrane-disrupting motifsConsider lipophilicity and membrane permeabilityDisrupt protein-membrane interaction

Experimental Evidence for Inhibitor Development:
Previous studies have identified several plsY inhibitors as potential antimicrobials . The development of a high-throughput enzymatic assay provides a valuable tool for screening potential inhibitors . The unique "substrate-assisted catalysis" mechanism of plsY suggests that effective inhibitors might work by:

  • Competing with substrate binding rather than targeting a catalytic residue

  • Disrupting the precise alignment of substrates necessary for the reaction

  • Introducing structural rigidity that prevents necessary conformational changes

The fact that plsY is absent in eukaryotes makes it an attractive target for antibacterial compounds with potentially minimal side effects on human cells . Inhibitor design strategies should focus on compounds that can penetrate the bacterial membrane to reach this integral membrane protein while maintaining specificity for the unique structural features of plsY.

How do the functional and structural characteristics of E. coli plsY compare with those from other bacterial species, particularly pathogens?

The functional and structural characteristics of plsY exhibit both conservation and variation across bacterial species, with important implications for both basic science understanding and therapeutic targeting. Here is a comparative analysis focusing on E. coli plsY versus plsY from other bacteria, particularly pathogens:

Sequence and Structural Conservation:

PlsY is highly conserved across bacterial species, reflecting its essential role in phospholipid biosynthesis . Key features that show strong conservation include:

  • The three critical motifs involved in catalysis (Motifs 1, 2, and 3)

  • The membrane topology with multiple transmembrane segments

  • The core catalytic mechanism using acyl-phosphate as the acyl donor

Species-Specific Variations:

Despite the core conservation, important variations exist between E. coli plsY and those from pathogenic species:

FeatureE. coli O81 PlsYStreptococcus pneumoniae PlsYFunctional Implication
Membrane topologySeven transmembrane helices Five membrane-spanning segments Potential differences in membrane integration
Amino acid sequence205 amino acids Species-specific lengthVariations in non-catalytic regions
Substrate preferenceSpecies-specific acyl chain preferencesMay prefer different acyl chain lengthsAdaptation to membrane composition requirements
Inhibitor sensitivityNoncompetitively inhibited by palmitoyl-CoA Species-specific inhibition profilesPotential for species-selective inhibitors

Functional Comparison in Pathogenic Contexts:

In most Gram-positive pathogens, plsY serves as the sole and therefore essential GPAT , making it potentially more critical as a drug target in these organisms compared to species like E. coli that may possess alternative pathways. This differential essentiality across bacterial species has important implications for antimicrobial development.

Streptococcus pneumoniae plsY has been particularly well-characterized using the substituted cysteine accessibility method (SCAM) , providing detailed insights into its membrane topology that complement the structural information available for other bacterial plsY proteins. This pathogen-derived structural information is valuable for comparative analyses and targeted drug design.

Implications for Research and Therapeutic Development:

  • Structure-Based Drug Design: The differences between plsY variants from different bacterial species can be exploited to develop species-selective inhibitors, potentially allowing for narrow-spectrum antibiotics that target specific pathogens while preserving beneficial microbiota .

  • Evolutionary Adaptation: Comparing plsY across species provides insights into how this essential enzyme has adapted to different membrane environments and metabolic contexts while maintaining its core function.

  • Resistance Mechanisms: Understanding species-specific characteristics of plsY helps predict potential resistance mechanisms that might emerge in response to plsY-targeting antimicrobials.

  • Model Selection for Research: The variations between E. coli and pathogen-derived plsY proteins highlight the importance of selecting appropriate bacterial models for specific research questions, particularly when translating findings toward therapeutic applications.

The comparative analysis of plsY across bacterial species represents a rich area for future research, with potential applications in both fundamental understanding of bacterial membrane biology and the development of novel antimicrobial strategies targeting this essential enzyme.

What are common challenges in expressing and purifying active recombinant plsY, and how can they be addressed?

Researchers working with recombinant plsY frequently encounter several challenges during expression and purification. These difficulties arise primarily from plsY's nature as an integral membrane protein with multiple transmembrane domains. Below are the most common challenges and evidence-based strategies to address them:

Challenge 1: Low Expression Yields

Membrane proteins like plsY often express at lower levels than soluble proteins due to potential toxicity and limitations in membrane insertion machinery .

Solutions:

  • Optimize expression conditions: Test different temperatures (16-30°C), induction times, and inducer concentrations

  • Use specialized expression strains: C41(DE3) or C43(DE3) E. coli strains are engineered for membrane protein expression

  • Consider expression vectors with tunable promoters: Leaky expression systems can allow for gradual accumulation

  • Explore fusion partners: N-terminal fusion tags like MBP or SUMO can improve folding and expression

Challenge 2: Protein Aggregation and Inclusion Body Formation

PlsY, with its multiple transmembrane domains, is prone to aggregation during expression and purification .

Solutions:

  • Optimize detergent selection: Systematic screening of detergents is critical:

DetergentAdvantagesLimitations
DDMGentle, maintains activityLarge micelles, may interfere with some assays
LDAOGood for crystallizationMay denature some membrane proteins
DigitoninVery mild, preserves complexesExpensive, heterogeneous
SDSHighly effective solubilizationTypically denatures protein
  • Use proper buffer components: Include glycerol (6-50%) and trehalose as stabilizing agents

  • Control temperature: Conduct all purification steps at 4°C to minimize aggregation

  • Incorporate lipids: Adding phospholipids during purification can stabilize the native conformation

Challenge 3: Loss of Activity During Purification

Maintaining the catalytic activity of plsY through multiple purification steps can be challenging.

Solutions:

  • Avoid repeated freeze-thaw cycles: This is explicitly mentioned as detrimental in the product notes

  • Store working aliquots at 4°C for up to one week

  • Use appropriate storage buffer: Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been shown to be effective

  • For long-term storage: Add glycerol to a final concentration of 50% and store at -20°C/-80°C

Challenge 4: Difficulty in Assessing Purity and Homogeneity

Traditional methods for assessing protein purity may be complicated by the presence of detergents.

Solutions:

  • Use SDS-PAGE with appropriate controls: Target purity should be >85-90% as determined by SDS-PAGE

  • Employ size exclusion chromatography: To distinguish between protein-detergent complexes and aggregates

  • Consider analytical ultracentrifugation: For rigorous assessment of homogeneity

  • Apply multiple purification strategies: Combine affinity chromatography with ion exchange and size exclusion steps

Challenge 5: Inconsistent Activity Assay Results

The acyltransferase activity of plsY can be difficult to measure consistently due to substrate instability and assay conditions.

Solutions:

  • Standardize substrate preparation: Ensure consistent quality of acyl-phosphate substrate

  • Control detergent concentration: Excess detergent can interfere with activity

  • Include appropriate controls: Use heat-inactivated enzyme as negative control

  • Develop robust assay protocols: The high-throughput enzymatic assay developed for plsY provides a standardized approach

By systematically addressing these challenges using the evidence-based approaches outlined above, researchers can improve their success in working with recombinant plsY, enabling more effective structural and functional studies of this important bacterial enzyme.

How can researchers differentiate between plsY activity and other cellular acyltransferases when conducting in vivo studies?

Differentiating plsY activity from other cellular acyltransferases in vivo is crucial for accurate interpretation of experimental results. This differentiation is particularly challenging because bacteria like E. coli possess multiple acyltransferases involved in phospholipid biosynthesis. Here are methodological approaches to achieve this specificity:

Genetic Manipulation Strategies

One of the most powerful approaches is the use of genetic systems to isolate plsY activity:

Conditional Knockout/Knockdown Systems:

  • Generate strains with plsY under the control of inducible promoters

  • Create depletion strains where plsY expression can be turned off

  • Employ CRISPR interference (CRISPRi) for targeted knockdown of plsY

Complementation Studies:
The plsB gene in E. coli encodes another glycerol-3-phosphate acyltransferase that uses acyl-CoA as a donor. Complementation studies can help distinguish between these activities:

Experimental ApproachExpected OutcomeControl Conditions
plsY expression in plsB-deficient strainRestoration of growth if plsY can substituteExpression of inactive plsY mutant
plsB expression in plsY-deficient strainRestoration of growth if redundantExpression of inactive plsB mutant
Double knockdown/knockoutSynergistic effects suggest distinct rolesSingle gene manipulations

Biochemical Discrimination Based on Substrate Specificity

PlsY uniquely uses acyl-phosphate as its acyl donor, while other acyltransferases typically use acyl-CoA or acyl-carrier protein . This substrate distinction can be exploited:

Substrate-specific Assays:

  • Provide cells with labeled acyl-phosphate precursors

  • Monitor incorporation into lysophosphatidic acid

  • Compare with labeled acyl-CoA incorporation patterns

Inhibitor-based Approaches:
PlsY is noncompetitively inhibited by palmitoyl-CoA , which can be used as a discriminating tool:

  • Measure acyltransferase activity with and without palmitoyl-CoA

  • plsY-specific activity will show characteristic inhibition pattern

  • Control with known inhibitors of other acyltransferases

Analytical Techniques for In Vivo Discrimination

Lipidomic Profiling:

  • Use mass spectrometry to analyze phospholipid compositions

  • Compare wild-type, plsY-depleted, and complemented strains

  • Look for specific changes in lysophosphatidic acid and phosphatidic acid species

  • Monitor acyl chain distributions that may be specifically processed by plsY

Metabolic Labeling:

  • Pulse-chase experiments with radioactive or isotopically labeled precursors

  • Time-course analysis to distinguish primary (direct) from secondary (downstream) effects

  • Combinatorial analysis with specific inhibitors

Molecular Tools for Specific Detection

Activity-based Protein Profiling:

  • Develop probes that specifically label active plsY

  • Use click chemistry approaches for visualization or enrichment

  • Compare labeling patterns across genetic backgrounds

Reporter Systems:

  • Engineer synthetic genetic circuits responsive to lysophosphatidic acid levels

  • Create fusion proteins that report on plsY activity or localization

  • Employ FRET-based sensors for real-time monitoring

Methodological Controls and Validation

To ensure that observed effects are specifically due to plsY activity:

  • Perform parallel experiments with catalytically inactive plsY mutants (e.g., mutations in the essential serine and arginine residues in Motif 1 )

  • Conduct rescue experiments with exogenous lysophosphatidic acid supplementation

  • Use heterologous expression of plsY homologs from other bacteria that might have different inhibition profiles

By combining these approaches, researchers can build a strong case for the specific involvement of plsY in observed phenotypes, distinguishing its activity from other cellular acyltransferases in in vivo experimental systems.

What strategies can be employed to investigate the interaction between plsY and its partner enzyme PlsX in the bacterial phospholipid synthesis pathway?

Investigating the interaction between plsY and its partner enzyme PlsX is crucial for understanding the coordinated pathway of bacterial phospholipid synthesis. PlsX converts acyl-acyl carrier protein to acyl-phosphate, which plsY then uses to acylate glycerol 3-phosphate . Below are sophisticated methodological strategies to elucidate this important enzyme partnership:

Biophysical Approaches for Direct Interaction Studies

Surface Plasmon Resonance (SPR):

  • Immobilize purified plsY on a sensor chip with controlled orientation

  • Flow purified PlsX over the surface at varying concentrations

  • Measure association and dissociation kinetics

  • Quantify binding affinity (KD) and interaction dynamics

Förster Resonance Energy Transfer (FRET):

  • Generate fusion constructs with appropriate fluorophore pairs (e.g., CFP-PlsX and YFP-plsY)

  • Express in bacterial systems and measure FRET efficiency

  • Use acceptor photobleaching or fluorescence lifetime measurements for quantification

  • Perform controls with non-interacting protein pairs

Isothermal Titration Calorimetry (ITC):

  • Measure thermodynamic parameters of binding (ΔH, ΔS, ΔG)

  • Determine stoichiometry of interaction

  • Assess effects of substrates, products, or inhibitors on binding

Structural Biology Approaches

Co-crystallization Studies:

  • Attempt co-crystallization of plsY and PlsX

  • Use cross-linking strategies to stabilize transient interactions

  • Solve the structure using X-ray crystallography

  • Include substrates/substrate analogs to capture the functional complex

Cryo-Electron Microscopy:

  • Particularly valuable if the complex is large or membrane-associated

  • Prepare the complex in nanodiscs or detergent micelles

  • Generate 3D reconstructions at various functional states

Nuclear Magnetic Resonance (NMR):

  • Use chemical shift perturbation to map interaction interfaces

  • Employ transferred NOE experiments to detect transient interactions

  • Study dynamics of the interaction with varying substrate concentrations

Genetic and Cellular Approaches

Bacterial Two-Hybrid Systems:

  • Adapt bacterial two-hybrid systems for membrane and cytoplasmic protein interactions

  • Screen for mutations that disrupt interaction

  • Validate findings with biochemical approaches

Co-Localization Studies:

  • Generate fluorescently tagged versions of plsY and PlsX

  • Perform fluorescence microscopy to assess co-localization patterns

  • Use super-resolution techniques for nanoscale spatial relationships

  • Analyze dynamics using FRAP (Fluorescence Recovery After Photobleaching)

Synthetic Lethality Analysis:

  • Generate conditional mutations in both enzymes

  • Assess genetic interactions through growth phenotypes

  • Identify suppressors that restore pathway function

Biochemical and Enzymatic Studies

Coupled Enzyme Assays:

  • Develop assays that monitor the sequential activities of PlsX and plsY

  • Compare kinetics of coupled versus individual reactions

  • Test the hypothesis of substrate channeling between enzymes

Comparative Analysis Across Species:
Create a data table comparing interaction parameters across bacterial species:

Bacterial SpeciesInteraction Detection MethodKD ValueNotes on Physiological Significance
E. coli[Method 1][Value 1][Observation 1]
S. pneumoniae[Method 2][Value 2][Observation 2]
B. subtilis[Method 3][Value 3][Observation 3]

Cross-linking Studies:

  • Use chemical cross-linkers with varying spacer lengths

  • Identify cross-linked products by mass spectrometry

  • Map interaction interfaces by analyzing cross-linked peptides

Computational Approaches

Molecular Dynamics Simulations:

  • Model the interaction between plsY and PlsX in a membrane environment

  • Simulate substrate transfer between the enzymes

  • Identify potential interaction interfaces

Protein-Protein Docking:

  • Use available structural data to predict interaction modes

  • Validate predictions with mutagenesis experiments

  • Refine models based on experimental constraints

Evolutionary Covariance Analysis:

  • Identify co-evolving residues between plsY and PlsX

  • Infer potential interaction surfaces

  • Test predictions through targeted mutagenesis

By integrating these diverse approaches, researchers can build a comprehensive understanding of the plsY-PlsX interaction, potentially revealing mechanisms of substrate channeling, regulatory control points, and opportunities for selective disruption of bacterial phospholipid synthesis.

What are the prospects for developing selective inhibitors of plsY as novel antibacterial agents?

The development of selective inhibitors targeting plsY represents a promising frontier in antibacterial drug discovery, with several key factors supporting this approach:

Compelling Rationale for plsY as an Antibacterial Target:

  • Essential Bacterial Function: PlsY catalyzes the committed and essential step in bacterial phospholipid biosynthesis, making it indispensable for bacterial survival .

  • Bacterial Specificity: PlsY has no eukaryotic homologs and uses a unique acyl-phosphate substrate, potentially enabling the development of inhibitors with minimal off-target effects in humans .

  • Ubiquitous Distribution: PlsY is found across bacterial species, including important pathogens, suggesting the potential for broad-spectrum activity .

  • Structural Characterization: The crystal structure of plsY at 1.48 Å resolution provides a detailed template for structure-based drug design .

Current State of Inhibitor Development:

Strategic Approaches to Inhibitor Development:

Structure-Based Design:

  • Utilize the high-resolution crystal structure to design compounds that interact with critical binding sites

  • Focus on the unique active site architecture revealed by substrate- and product-bound structures

  • Target the relatively inflexible active site with rigid inhibitor scaffolds

Mechanism-Based Inhibitors:

  • Exploit the "substrate-assisted catalysis" mechanism by designing transition state analogs

  • Develop acyl-phosphate mimetics that compete with the natural substrate

  • Create covalent inhibitors targeting catalytically essential residues identified through mutagenesis

Fragment-Based Drug Discovery:

  • Screen fragment libraries against plsY using NMR or X-ray crystallography

  • Grow or link promising fragments to develop high-affinity inhibitors

  • Optimize physicochemical properties for membrane penetration

Predictive Models for Successful Inhibitors:

PropertyOptimal RangeRationale
Molecular Weight350-550 DaBalance between potency and membrane permeability
Lipophilicity (logP)2-4Necessary to access the membrane-embedded target
Polar Surface Area75-140 ŲFacilitate crossing bacterial cell wall
H-bond Donors1-3Reduce desolvation penalty
H-bond Acceptors3-7Maintain target interaction

Challenges and Mitigation Strategies:

  • Membrane Penetration: Inhibitors must reach the membrane-embedded plsY

    • Strategy: Incorporate cell-penetrating moieties or prodrug approaches

  • Resistance Development: Bacteria may evolve resistance through mutations

    • Strategy: Target highly conserved regions and develop combination approaches

  • Spectrum of Activity: Different bacterial species may have variations in plsY structure

    • Strategy: Focus on conserved motifs identified through comparative analysis

  • Selectivity vs. Broad Spectrum: Balancing specific targeting with wide coverage

    • Strategy: Develop inhibitor panels with tuned selectivity profiles

Translational Research Pathway:

  • High-Throughput Screening: Utilize the developed enzymatic assay to screen diverse compound libraries

  • Lead Optimization: Refine hits through medicinal chemistry guided by structure-activity relationships

  • In Vitro Validation: Test against panels of clinically relevant bacterial strains

  • In Vivo Efficacy: Evaluate pharmacokinetics, toxicity, and efficacy in animal models

  • Resistance Profiling: Assess the potential for resistance development through serial passage experiments

The development of plsY inhibitors represents a scientifically sound approach to address the growing challenge of antibiotic resistance. The unique aspects of plsY—its essential function, bacterial specificity, and well-characterized structure—provide a strong foundation for drug discovery efforts that could yield novel antibacterial agents with distinctive mechanisms of action.

How might techniques like cryo-electron microscopy advance our understanding of plsY structure and function in membrane contexts?

Cryo-electron microscopy (cryo-EM) has revolutionized structural biology, particularly for membrane proteins like plsY. This technique offers several unique advantages that could significantly advance our understanding of plsY beyond what has been achieved with traditional crystallography:

Preservation of Native Membrane Environment:

While the crystal structure of plsY at 1.48 Å resolution has provided valuable insights , cryo-EM offers the opportunity to study plsY in a more native-like membrane environment:

  • Lipid Nanodisc Studies:

    • PlsY can be reconstituted into nanodiscs with defined lipid compositions

    • This approach preserves the annular lipid shell that may influence protein conformation

    • Different bacterial membrane compositions can be mimicked to study species-specific effects

  • Visualization of Membrane Deformation:

    • Observe how plsY integration affects local membrane curvature or thickness

    • Study if the seven-transmembrane helix fold causes specific membrane adaptations

    • Investigate potential lipid sorting effects around the protein

Conformational Dynamics and Functional States:

Cryo-EM excels at capturing multiple conformational states within a single sample:

  • Conformational Ensemble Analysis:

    • Classify particles into distinct conformational states

    • Map the energy landscape of plsY conformational changes

    • Identify potential intermediate states in the catalytic cycle

  • Time-Resolved Studies:

    • Use microfluidic mixing devices to capture short-lived intermediates

    • Visualize substrate-induced conformational changes

    • Track the progression of the acyl transfer reaction

Table: Potential Conformational States for Cryo-EM Investigation

Functional StateExperimental ConditionExpected Structural FeaturesFunctional Significance
Apo stateNo substratesBaseline structureReference state
Acyl-phosphate bound+ Acyl-phosphateChanges in substrate binding pocketSubstrate recognition
G3P bound+ Glycerol 3-phosphateMotif 2 rearrangementsG3P binding mechanism
Ternary complex+ Both substratesAligned catalytic residuesPre-catalytic state
Product bound+ Lysophosphatidic acidPost-catalytic conformationProduct release mechanism
Inhibitor bound+ Known inhibitorsInhibition mechanismDrug design insights

Protein-Protein Interactions in Native Context:

Cryo-EM is particularly powerful for studying multi-protein complexes:

  • PlsY-PlsX Complex:

    • Investigate the hypothesized interaction between plsY and PlsX

    • Visualize how substrate channeling might occur between the enzymes

    • Map the interaction interface at the membrane boundary

  • Integration with Other Membrane Components:

    • Study potential associations with other phospholipid biosynthetic enzymes

    • Examine co-localization with membrane microdomains

    • Investigate interactions with the cell division machinery

Methodological Advances Specifically Beneficial for PlsY Studies:

  • New Sample Preparation Techniques:

    • Graphene supports to minimize background and improve signal-to-noise ratio

    • Optimized reconstitution protocols for membrane proteins

    • GraFix or mild cross-linking to stabilize transient complexes

  • Image Processing Innovations:

    • Improved 3D variability analysis to detect subtle conformational changes

    • Local refinement techniques to resolve flexible domains

    • Multi-body refinement for capturing domain movements

  • Integrative Approaches:

    • Combine cryo-EM with molecular dynamics simulations

    • Correlate with functional data from enzymatic assays

    • Validate with cross-linking mass spectrometry

Potential Research Questions Addressable by Cryo-EM:

  • How does the membrane composition affect plsY structure and activity?

  • What conformational changes occur during substrate binding and catalysis?

  • Does plsY form higher-order assemblies or localize to specific membrane regions?

  • How do inhibitors modulate plsY structure and membrane integration?

  • What is the structural basis for species-specific differences in plsY function?

The application of cryo-EM to plsY research would complement existing crystallographic data and biochemical characterization , potentially revealing dynamic aspects of this enzyme's function that have remained elusive. This approach could significantly advance both fundamental understanding and applied research aimed at developing new antibacterial strategies targeting this essential bacterial enzyme.

What are emerging approaches for studying the role of plsY in bacterial membrane homeostasis and cell division?

The study of plsY's role in bacterial membrane homeostasis and cell division represents an emerging frontier that bridges molecular enzymology with cellular physiology. Several innovative approaches are being developed to elucidate these connections:

Advanced Imaging Techniques for Spatiotemporal Analysis:

Super-Resolution Microscopy:

  • Techniques like PALM, STORM, or STED can visualize plsY localization with nanometer precision

  • Dual-color imaging with markers for cell division machinery (FtsZ, PBPs) can reveal potential co-localization

  • Time-lapse super-resolution microscopy can track dynamic redistribution during the cell cycle

Correlative Light and Electron Microscopy (CLEM):

  • Combine fluorescence microscopy of tagged plsY with electron microscopy

  • Visualize both protein localization and membrane ultrastructure

  • Reveal precise positioning relative to membrane features and division sites

Fluorescent Lipid Probes:

  • Use fluorescently labeled lipid precursors to track synthesis patterns

  • Monitor changes in lipid distribution during cell cycle progression

  • Correlate with plsY localization to identify active synthesis sites

Genetic and Molecular Tools for Functional Analysis:

CRISPRi Knockdown Systems:

  • Create tunable depletion of plsY using dCas9-based repression

  • Monitor effects on membrane composition and cell division

  • Analyze dose-dependent phenotypes to distinguish direct and indirect effects

Fluorescent Protein Fusions with Minimal Perturbation:

  • Develop split-GFP or HaloTag systems for minimal disruption of plsY function

  • Create inducible expression systems to control timing of visualization

  • Combine with photoactivatable fluorophores for pulse-chase experiments

Synthetic Biology Approaches:

  • Engineer orthogonal lipid synthesis pathways to study plsY in isolation

  • Create synthetic genetic circuits that respond to membrane stress

  • Develop biosensors for lysophosphatidic acid to monitor plsY activity in vivo

Multiomics Integration for Systems-Level Understanding:

Spatially Resolved Lipidomics:

  • Apply MALDI imaging mass spectrometry to map lipid distributions

  • Correlate with plsY activity zones in the bacterial cell

  • Develop methods for single-cell lipidomics during division

Quantitative Proteomics:

  • Use proximity labeling (BioID, APEX) to identify proteins near plsY

  • Measure changes in the membrane proteome upon plsY modulation

  • Perform temporal proteomics throughout the cell cycle

Transcriptomics-Proteomics Integration:

  • Analyze co-regulation patterns between plsY and cell division genes

  • Identify potential regulatory networks connecting lipid synthesis to division

  • Compare across growth conditions and stress responses

Methodological Table: Approaches to Study PlsY in Membrane Homeostasis and Division

ApproachTechniqueKey Parameters MeasuredAdvantagesChallenges
Localization DynamicsFluorescence Microscopy with photoactivatable plsYProtein redistribution during cell cycleDirect visualization in living cellsPotential functional interference
Membrane Composition AnalysisLC-MS/MS LipidomicsChanges in phospholipid profiles upon plsY modulationComprehensive lipid profilingSample preparation artifacts
Protein-Protein InteractionsBioID proximity labelingProteins in close proximity to plsYWorks in native conditionsBackground labeling issues
Membrane Physical PropertiesFluorescence AnisotropyMembrane fluidity changesMeasures functional consequences of altered lipid compositionIndirect measure of plsY activity
Division Machinery CouplingDual-color PALMCo-localization with FtsZ and other division proteinsNanoscale resolutionComplex image analysis

Biophysical Approaches to Understand Membrane Effects:

Atomic Force Microscopy:

  • Measure nanomechanical properties of bacterial membranes with modified plsY activity

  • Correlate membrane rigidity with lipid composition changes

  • Map surface topography during division with nanometer precision

Solid-State NMR:

  • Measure lipid ordering and dynamics in membranes with varied plsY activity

  • Detect changes in membrane thickness or curvature

  • Study specific lipid-protein interactions

Neutron Reflectometry:

  • Analyze membrane structure and organization in reconstituted systems

  • Measure effects of plsY activity on bilayer properties

  • Compare native membrane extracts with synthetic systems

Emerging Hypotheses and Research Questions:

  • Spatial Regulation Hypothesis: Does plsY localize to specific regions to direct new phospholipid synthesis during cell growth and division?

  • Divisome Integration Question: Does plsY interact directly with division proteins to coordinate membrane and cell wall synthesis?

  • Feedback Regulation Inquiry: How do membrane physical properties feedback to regulate plsY activity?

  • Stress Response Investigation: How does plsY activity adapt to environmental stresses that affect membrane integrity?

These emerging approaches collectively offer a comprehensive toolkit for investigating the critical role of plsY beyond its enzymatic function, connecting molecular mechanisms to cellular physiology and potentially revealing new strategies for antimicrobial intervention targeting bacterial cell division and membrane homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.