Recombinant Escherichia coli O81 Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; ECED1_3954; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
mscL
Target Protein Sequence
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LREAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAATPAPTKEE VLLTEIRDLLKEQNNRS
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MscL channel and what is its primary function in E. coli?

The Mechanosensitive channel of Large conductance (MscL) functions as a pressure-relief valve that protects bacterial cells from lysis during acute osmotic downshock. When the membrane is stretched due to increased osmotic pressure, MscL responds to the tension increase and opens a nonselective pore approximately 30 Å wide, exhibiting a large unitary conductance of ~3 nS . This opening allows the rapid release of osmolytes, preventing cell rupture during hypoosmotic shock . MscL was first identified in 1994 and has since been recognized as a model system for studying the molecular basis of mechanosensation .

How is MscL structured at the molecular level?

MscL is a homopentameric protein comprising subunits of 136 amino acid residues (15 kDa) each . The protein spans the inner membrane of E. coli twice, with both N- and C-termini located in the cytoplasm . Each subunit contains:

  • Two transmembrane helices (TM1 and TM2)

  • A periplasmic loop connecting TM1 and TM2

  • An N-terminal helix (N-helix) on the cytoplasmic side

  • A C-terminal domain also on the cytoplasmic side

The gate of the MscL channel is formed by a 'hydrophobic lock,' consisting of a cluster of hydrophobic residues in the channel pore . The closed-to-open transition involves an iris-like expansion of the channel pentamer . Spectroscopic techniques have confirmed that the protein is highly helical in structure .

What are the gating parameters of MscL in response to membrane tension?

MscL exhibits a steep sigmoidal dependence on membrane tension, with specific biophysical parameters:

ParameterValueNotes
Midpoint tension (T₁/₂)11.8 dyn/cmPoint at which Po/Pc = 1
Maximal slope sensitivity0.63 dyn/cm per e-foldChange in Po/Pc with tension
Energy difference (ΔE)18.6 kᵦTBetween closed and open states
Area change (ΔA)6.5 nm²In-plane area change during gating

The tension required to gate wild-type MscL is approximately 9-10 mN/m . The channel is not binary but has four conducting states and a closed state . The rate-limiting step to opening is the transition between the closed state and the lowest conductance substate, which involves the greatest change in membrane area .

How can MscL be recombinantly expressed in E. coli?

For recombinant expression of MscL in E. coli, researchers typically use the following methodological approach:

  • Vector selection: Use expression vectors with inducible promoters, such as the rhamnose-inducible promoter system (pRha) .

  • Signal peptide selection: Fuse the MscL gene with appropriate signal peptides for proper localization. Common signal peptides include those from DsbA, OmpA, PhoA, and Hbp autotransporter proteins .

  • Expression conditions: Optimize expression by varying inducer concentration. Lower rhamnose concentrations (e.g., 100 μM) often yield better results for proper folding and localization .

  • Host strain selection: E. coli BL21(DE3) is commonly used for high-level expression, while K-12 strains like BW25113 can be used for more controlled expression .

  • Purification strategy: Incorporate a C-terminal His₆-tag for isolation using immobilized-metal affinity chromatography (IMAC) followed by size exclusion chromatography (SEC) .

The choice of expression system significantly affects protein yield, localization, and functionality .

How do translation stress and osmotic stress coordinate to regulate MscL-dependent protein excretion?

Recent research has revealed a novel connection between translation stress, osmotic stress, and MscL-dependent excretion of cytoplasmic proteins (ECP). This process involves:

  • Translation stress induction: Both recombinant protein overexpression and antibiotic-induced translation stress trigger ECP .

  • ArfA mediation: The alternative ribosome rescue factor A (ArfA) plays a critical role in sensing and responding to translation stress .

  • Osmotic stress coupling: Translation stress is linked to changes in osmotic conditions, creating hypo-osmotic stress that activates MscL .

  • MscL-dependent excretion: Under these conditions, cytoplasmic proteins are excreted across the inner membrane into the periplasmic space via MscL channels .

Experimental validation of this pathway involved:

  • Metabolomic and proteomic analyses

  • Genetic knockouts of MscL and ArfA

  • Monitoring protein localization under different stress conditions

This mechanism represents a physiologically relevant excretion pathway, as it was validated in both recombinant and wild-type backgrounds . The excretion of cytoplasmic proteins can reach yields of ~0.7 g/liter with 60-80% purity, making it potentially valuable for biotechnological applications .

What experimental approaches are used to measure MscL gating parameters?

Researchers employ several sophisticated techniques to measure MscL gating parameters:

  • Patch-clamp electrophysiology:

    • The primary method for characterizing MscL conductance and gating

    • Allows direct measurement of channel opening in response to membrane tension

    • Membrane tension (σ) is calculated from applied negative pressure (ΔP) and patch curvature (r) using the Laplace-Young equation: σ = 2rΔP

    • Typical values involve negative pressure of 5×10³ Pa (0.05 atm) to generate tension of 10 mN/m⁻¹ in a 1 μm diameter patch

  • Reconstitution in liposomes:

    • Purified MscL is incorporated into liposomes for controlled studies

    • Allows manipulation of lipid composition to study membrane effects

    • Combined with video microscopy to measure patch radius of curvature

  • Droplet hydrogel bilayers (DHBs):

    • Novel approach using droplets stabilized by monolayers of lipids

    • Allows mechanical stimulation by buffer injection into the droplet

    • Tension in the bilayer (Tᵦ) calculated as Tᵦ = ΔTₘ·cos(θ), where ΔTₘ is the change in monolayer tension

    • Droplet monolayer tension calculated as ΔTₘ = K·(ΔA/A), where K is the area modulus of elasticity

These approaches provide quantitative measurements of tension-dependent gating, allowing determination of energy parameters and structural changes during channel opening .

How do the different domains of MscL coordinate during the gating process?

The gating of MscL involves highly coordinated movements among its structural elements:

  • Transmembrane helices (TM1 and TM2):

    • Undergo significant changes in tilt angles during channel expansion

    • Follow a helix-pivoting model where the helices tilt outward to expand the pore

  • Periplasmic loop region:

    • Transforms from a folded structure (containing an ω-shaped loop and a short β-hairpin) to an extended and partly disordered conformation during channel expansion

    • Serves as a spring-like element that can stretch out in response to membrane tension

    • Deletion of residues from the ω-loop region (e.g., Gly51-Thr56) abolishes channel function

  • N-terminal helix (N-helix):

    • Undergoes significant rotation and sliding coupled to the tilting movements of TM1 and TM2

    • Functions as a membrane-anchored stopper that limits the tilts of TM1 and TM2 during gating

The gating process resembles a nanoscale mechanical valve with coupled and coordinated movements of each structural element . This complex conformational rearrangement allows the channel to expand from the closed state to create a pore large enough for the passage of ions, small molecules, and even some proteins .

What is the relationship between MscL and other mechanosensitive channels in E. coli?

E. coli contains multiple mechanosensitive channels that form a hierarchical system responding to different tension thresholds:

ChannelConductanceTension ThresholdIdentified YearFamily
MscL~3 nSHighest (near lytic limit)1994MscL family
MscS25 pALower than MscLLaterMscS family
MscK17.5 pASimilar to MscSLaterMscS family
MscM~7.5 pALowestLater(Potential component: YbdG)
YjeP5-8 pAVariableRecentNovel activities
YnaI~2 pAVariableRecentNovel activities

The tension required to open each channel is conventionally reported as a ratio between the pressure to open that channel and the pressure to open MscL in each test patch . This hierarchical arrangement allows for a graded response to increasing membrane tension, with MscL acting as the final "emergency release valve" when tension approaches the lytic limit of the cell membrane .

Recent research has identified additional mechanosensitive channel activities in E. coli beyond the well-characterized MscL, MscS, and MscK channels . These findings suggest that E. coli possesses a more complex array of mechanosensitive channels than previously recognized, potentially serving diverse physiological functions beyond osmotic regulation .

How can site-directed mutagenesis reveal functional aspects of MscL?

Site-directed mutagenesis has been instrumental in understanding MscL function:

  • Tension sensitivity modification:

    • Introduction of polar or charged residues in the hydrophobic lock region makes the channel more sensitive to bilayer tension

    • The G22S mutant opens approximately 30% more easily than wild-type MscL, making it useful for experimental studies requiring lower activation thresholds

  • Periplasmic loop function:

    • Deletion of six residues (Gly51-Thr56) from the ω-loop region abolishes channel function during osmotic downshock

    • Mutations in this region affect gating kinetics and mechanosensitivity

  • Gain-of-function screening:

    • Random mutagenesis followed by selection for slow-growth phenotypes can identify residues critical for channel gating

    • These mutants often reveal amino acids involved in stabilizing the closed state

  • Cysteine substitution:

    • Introduction of cysteines at specific positions allows for disulfide cross-linking experiments

    • These experiments have helped validate and refine the iris-like open-state model of MscL

  • Electrostatic repulsion testing:

    • Introduction of charged residues at specific positions can create repulsive forces that mimic the effect of tension

    • This approach has been used to verify models of channel gating

Methodologically, these mutagenesis studies typically involve:

  • PCR-based site-directed mutagenesis

  • Expression in MscL-null backgrounds to avoid interference from native channels

  • Functional characterization using patch-clamp electrophysiology or in vivo osmotic shock survival assays

What methodological approaches are used to study MscL-dependent protein excretion?

Investigating MscL-dependent protein excretion requires a multifaceted experimental approach:

  • Recombinant protein expression systems:

    • Use of inducible promoters (e.g., rhamnose-inducible) for controlled expression

    • Testing different signal peptides (DsbA, OmpA, PhoA, Hbp) for optimal targeting

    • Titration of inducer concentrations to find optimal expression conditions

  • Fractionation and localization analysis:

    • Separation of cellular fractions (cytoplasm, periplasm, medium)

    • Analysis of protein localization by SDS-PAGE and immunoblotting

    • Quantification of protein in different fractions by densitometry

  • Genetic validation:

    • Generation of knockout strains (e.g., ΔmscL, ΔarfA)

    • Complementation studies with episomal expression of the deleted genes

    • Comparison of protein localization between wild-type and knockout strains

  • Stress induction experiments:

    • Application of translation stress through antibiotics or protein overexpression

    • Monitoring of osmotic conditions through measurement of medium osmolality

    • Analysis of metabolic footprints to detect stress signatures

  • Proteomic and metabolomic analyses:

    • Condition-specific proteome analysis to identify stress response signatures

    • Metabolomic profiling to detect changes associated with excretion

    • Correlation of identified patterns with protein excretion phenotypes

This integrated approach has revealed that protein overexpression in recombinant cells and antibiotic-induced translation stress both lead to excretion of cytoplasmic proteins via MscL channels, with involvement of the alternative ribosome rescue factor A (ArfA) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.